[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67750.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->91 PF08755 * YccV-like 0.00033 24.0 50/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67750.1 GT:GENE BAC67750.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(50521..50901) GB:FROM 50521 GB:TO 50901 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67750.1 LENGTH 126 SQ:AASEQ MMKSVIRKAAGLAGASVAVAAMSVTGASAAQAESPTHGCPYPYVCFYVDEDAYNAGTPITKYRDVTSSYQTVRSRPHYHVVNTRNDDVAYLRLQDGNSICLVPNSETVFANAYSVTGIKISSSSTC GT:EXON 1|1-126:0| SEG 9->32|aaglagasvavaamsvtgasaaqa| HM:PFM:NREP 1 HM:PFM:REP 41->91|PF08755|0.00033|24.0|50/100|YccV-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 124-126| PSIPRED cHHHHHHHHHccccccEEEEEEEEccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccccEEEEEEccccEEEEEEcccEEEEEEEEEEEEEEcccccc //