[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67755.1
DDBJ      :             putative IS5 family IS1421-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 12->100 YI22_BURCE 6e-28 60.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67755.1 GT:GENE BAC67755.1 GT:PRODUCT putative IS5 family IS1421-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(56052..56441) GB:FROM 56052 GB:TO 56441 GB:DIRECTION - GB:PRODUCT putative IS5 family IS1421-like transposase GB:NOTE IS5 family (55644..56560). Inverted repeat sequence (12/14 bp). GB:PROTEIN_ID BAC67755.1 LENGTH 129 SQ:AASEQ MLPKPAPKLVEGRPRVPDRQALCGILFVLHTGIQWEYLPQELGFGSGMTCWRRLAAWNEAGVWNRLHVLLLEKLRSKDKLDWSRAVIDSSHVRAARRGPKADPARSTAHVRAASTTSSPTARASRSRCR GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 12->100|YI22_BURCE|6e-28|60.7|89/100| SEG 111->127|raasttssptarasrsr| OP:NHOMO 176 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------------33----1----------1----------T623-------------------------------------------------------------------55---------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------11-1111111--3------4-3--1-------------------------------------1--1-------------------------------------------18-1D-----31-2---1-1C---------6--4--A2-----------2----------E3-------------------------------1---------------------------------------------------------------------------3----------------------------------------------------------------2----------------------------------------------------------1----------2------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 4-13, 93-129| PSIPRED ccccccccccccccccHHHHHHHHHHHHHHccccHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHEEEEcccccccccccccccccccccccccccccccccccccccccc //