[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67758.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:97 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  21->89 1av5A  d.13.1.1 * 2e-05 23.2 %
:HMM:PFM   28->89 PF01230 * HIT 1e-05 32.2 59/98  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67758.1 GT:GENE BAC67758.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 58919..59212 GB:FROM 58919 GB:TO 59212 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67758.1 LENGTH 97 SQ:AASEQ MEWWWRRTGCWRSTTPGRRIPFTSWWFPRDHAPSLIDFGAGGEELLAEVIRVVRTVAAQVEQQHGACSVMTNLGLYRESKHQHWHVVHRGEPRTEVP GT:EXON 1|1-97:0| HM:PFM:NREP 1 HM:PFM:REP 28->89|PF01230|1e-05|32.2|59/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 21->89|1av5A|2e-05|23.2|69/113|d.13.1.1| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------11--------------------1---------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 93-97| PSIPRED ccccccccccccccccccccccccccccHHHccHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHEEEEEEccccccccc //