[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67761.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   35->67 PF04888 * SseC 0.00022 33.3 33/306  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67761.1 GT:GENE BAC67761.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(62965..63342) GB:FROM 62965 GB:TO 63342 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67761.1 LENGTH 125 SQ:AASEQ MHPIGGAGNAGVNDCPLYSVPVRIHSVTDSDARPEKTGEVVNKIKKAAAVAVMVGGMALGGGAAHAAGGHGLDDPADIIIGNLQAVNCDQDFAGGAAFAPVQGISTEGNTQNIGSFCTVVGPVYD GT:EXON 1|1-125:0| TM:NTM 1 TM:REGION 47->69| SEG 47->72|aaavavmvggmalgggaahaagghgl| HM:PFM:NREP 1 HM:PFM:REP 35->67|PF04888|0.00022|33.3|33/306|SseC| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------6------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 29-38| PSIPRED ccccccccccccccccEEEccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcccEEEcccccccccEEEccHHHHHccccccccccEEEEEccccc //