[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67763.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:35 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->31 PF02254 * TrkA_N 0.00099 42.9 21/116  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67763.1 GT:GENE BAC67763.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(64481..64588) GB:FROM 64481 GB:TO 64588 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67763.1 LENGTH 35 SQ:AASEQ MWPGARGIGRGAGRTGRGIAPLLPQGERRFSVTGP GT:EXON 1|1-35:0| SEG 4->20|gargigrgagrtgrgia| HM:PFM:NREP 1 HM:PFM:REP 11->31|PF02254|0.00099|42.9|21/116|TrkA_N| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 31-35| PSIPRED ccccccccccccccccccccccccccccEEEcccc //