[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67764.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->62 PF02369 * Big_1 0.00068 37.9 29/100  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67764.1 GT:GENE BAC67764.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(64632..65045) GB:FROM 64632 GB:TO 65045 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67764.1 LENGTH 137 SQ:AASEQ MTLTATVTCSADPSRVLLGLTFFDGGDILGEVSVDSSGHAQYTTTFATTGTHTITAAYNGNANCFASNSMTTVQVSAAPVPPTPPGHGLCRDDCCGLINIHLGGIKTSVGVDRVRSSLARWLTPRLPYPARLQGLTR GT:EXON 1|1-137:0| SEG 40->57|aqytttfattgthtitaa| HM:PFM:NREP 1 HM:PFM:REP 34->62|PF02369|0.00068|37.9|29/100|Big_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 136-137| PSIPRED cEEEEEEEEccccccccccEEEEccccEEEEEEEccccEEEEEEEEEEcccEEEEEEEccccEEEEcccccEEEEEEccccccccccccccccccEEEEEEEccEEccccHHHHHHHHHHHHcccccccHHcccccc //