[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67765.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:60 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->32 PF09476 * Pilus_CpaD 0.00074 21.4 28/203  
:REPEAT 2|2->11|23->32
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67765.1 GT:GENE BAC67765.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(65216..65398) GB:FROM 65216 GB:TO 65398 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67765.1 LENGTH 60 SQ:AASEQ MPRCTREPSPVTVQDSANNASRPRCARWPKWVDWAGASLGRESPRRSVRLPDRLRRTFVL GT:EXON 1|1-60:0| NREPEAT 1 REPEAT 2|2->11|23->32| SEG 43->56|sprrsvrlpdrlrr| HM:PFM:NREP 1 HM:PFM:REP 5->32|PF09476|0.00074|21.4|28/203|Pilus_CpaD| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-19, 43-47| PSIPRED ccccccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHccc //