[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67766.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:351 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   179->211 2uzyD PDBj 2e-04 53.1 %
:RPS:PDB   39->103 3brgC PDBj 6e-07 19.0 %
:RPS:PDB   178->264 3brgC PDBj 2e-10 24.4 %
:RPS:SCOP  35->99 1a47A1  b.1.18.2 * 3e-04 18.2 %
:RPS:SCOP  184->263 1a47A1  b.1.18.2 * 3e-08 12.8 %
:HMM:SCOP  19->99 1pamA1 b.1.18.2 * 5.9e-15 45.6 %
:HMM:SCOP  101->182 1pamA1 b.1.18.2 * 1.2e-16 46.2 %
:HMM:SCOP  183->263 1pamA1 b.1.18.2 * 4.3e-15 45.6 %
:HMM:SCOP  265->348 1pamA1 b.1.18.2 * 2.8e-14 42.7 %
:HMM:PFM   21->99 PF01833 * TIG 2.9e-14 32.9 79/85  
:HMM:PFM   103->181 PF01833 * TIG 3.7e-15 38.0 79/85  
:HMM:PFM   185->263 PF01833 * TIG 5.2e-14 39.2 79/85  
:HMM:PFM   267->344 PF01833 * TIG 2.3e-14 34.6 78/85  
:BLT:SWISS 37->94 CDGT1_PAEMA 3e-04 43.1 %
:BLT:SWISS 185->263 PLXA3_HUMAN 2e-05 32.9 %
:REPEAT 4|54->101|136->183|218->265|300->347
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67766.1 GT:GENE BAC67766.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(65536..66591) GB:FROM 65536 GB:TO 66591 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01833: IPT/TIG domain GB:PROTEIN_ID BAC67766.1 LENGTH 351 SQ:AASEQ MKDSPPAAGAVRPAAVVAAVPVLTSVVPSTGPAAGNNNVTLNGSGFSGVTAVLFGTKPALGYTVDSTTKITAVAPSGTGTVAVTVKTPGGTSNSVAYTYAAQPSLTSVSPSQGPSSGGTTVILTGTGLSAATAVTFGSTPAAGYTVNSATQITAVAPAGTGAVPITVTTPGGTTGPVYFFYVNAPTVTSVSPGQGPASGGTTVILTGADLSAATAVTFGSTPATGYTVNSPSQITAVAPAGTGSVAVTVTGPGGVSNSVIYTYVASPVLSSLVPVLGPTGAGAGVTLTGSGLTTTTAVRFGAVSAAFTVLSDTTVAAYAPAGVPGPVLVNVTTAGGTSNSLTYTRVAPPVI GT:EXON 1|1-351:0| BL:SWS:NREP 2 BL:SWS:REP 37->94|CDGT1_PAEMA|3e-04|43.1|58/714| BL:SWS:REP 185->263|PLXA3_HUMAN|2e-05|32.9|79/1871| NREPEAT 1 REPEAT 4|54->101|136->183|218->265|300->347| SEG 5->32|ppaagavrpaavvaavpvltsvvpstgp| SEG 104->129|sltsvspsqgpssggttviltgtgls| SEG 158->177|agtgavpitvttpggttgpv| SEG 266->298|spvlsslvpvlgptgagagvtltgsglttttav| SEG 315->329|vaayapagvpgpvlv| BL:PDB:NREP 1 BL:PDB:REP 179->211|2uzyD|2e-04|53.1|32/618| RP:PDB:NREP 2 RP:PDB:REP 39->103|3brgC|6e-07|19.0|64/414| RP:PDB:REP 178->264|3brgC|2e-10|24.4|86/414| HM:PFM:NREP 4 HM:PFM:REP 21->99|PF01833|2.9e-14|32.9|79/85|TIG| HM:PFM:REP 103->181|PF01833|3.7e-15|38.0|79/85|TIG| HM:PFM:REP 185->263|PF01833|5.2e-14|39.2|79/85|TIG| HM:PFM:REP 267->344|PF01833|2.3e-14|34.6|78/85|TIG| RP:SCP:NREP 2 RP:SCP:REP 35->99|1a47A1|3e-04|18.2|65/83|b.1.18.2| RP:SCP:REP 184->263|1a47A1|3e-08|12.8|78/83|b.1.18.2| HM:SCP:REP 19->99|1pamA1|5.9e-15|45.6|79/0|b.1.18.2|1/4|E set domains| HM:SCP:REP 101->182|1pamA1|1.2e-16|46.2|80/0|b.1.18.2|2/4|E set domains| HM:SCP:REP 183->263|1pamA1|4.3e-15|45.6|79/0|b.1.18.2|3/4|E set domains| HM:SCP:REP 265->348|1pamA1|2.8e-14|42.7|82/0|b.1.18.2|4/4|E set domains| OP:NHOMO 13 OP:NHOMOORG 10 OP:PATTERN ---------------------------------------------------1---------------- -------------------------------------------------------------------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------------------1--1------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 43.3 SQ:SECSTR ######################################EEEEEEcccTTEEEEETTEEccEEEE#ETTEEEEEcccGTcTTcccccccEEEEEEEEEEEcccc##########################################################################EEEETTcccccccccEEEEEccccEEEEEEEcccTTEEEEETTEEccEEEEEETTEEEEEcccGTcTTcccccccEEEEEEEEEEEcc###################################################################################### DISOP:02AL 1-14| PSIPRED cccccccccEEEEcEEEccccEEEEEEEccccccccEEEEEEEEccccEEEEEEccEEEEEEEEEccEEEEEEcccccEEEEEEEccccccccEEEEEEEcccEEEEEEEccccccccEEEEEEEcccccccEEEEccEEEEEEEEEcccEEEEEcccccccEEEEEEEcccEEcEEEEEEccccEEEEEcccccccccccEEEEEEcccccccEEEEccEEEEEEEEccccEEEEEccccccEEEEEEEEcccccccEEEEEEEccEEEEcccccccccccEEEEEEEccccccEEEEEccEEEEEEEEcccEEEEEccccccccEEEEEEEccEEEccEEEEEcccccc //