[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67767.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.1.18
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   195->244 2cxkB PDBj 6e-08 26.0 %
:RPS:SCOP  3->32 1a02N1  b.1.18.1 * 3e-04 30.0 %
:RPS:SCOP  195->241 1a47A1  b.1.18.2 * 2e-04 15.2 %
:HMM:SCOP  3->76 1pamA1 b.1.18.2 * 1.8e-12 47.2 %
:HMM:SCOP  78->158 1pamA1 b.1.18.2 * 1.1e-16 53.2 %
:HMM:SCOP  160->244 1d3cA1 b.1.18.2 * 7e-20 45.8 %
:HMM:PFM   3->76 PF01833 * TIG 8.4e-17 48.6 74/85  
:HMM:PFM   84->158 PF01833 * TIG 9.9e-19 44.0 75/85  
:HMM:PFM   162->241 PF01833 * TIG 1.1e-20 38.8 80/85  
:BLT:SWISS 3->34 PLXA4_MOUSE 5e-04 56.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67767.1 GT:GENE BAC67767.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(66803..67546) GB:FROM 66803 GB:TO 67546 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF01833: IPT/TIG domain GB:PROTEIN_ID BAC67767.1 LENGTH 247 SQ:AASEQ MPISPNQGSSGGGTLVTITGTNLTGTSAVRFGTRSATNVTNVSPTTVTAVSPSGSGSVGVTVTTPGGTSNPIPFYYVGAPFKQTLSPTSGSTAGGTTVTITGTGFSSATSVAFGANTVAPTVVSDSQLTAVAPAGAAGSVGVSVTTAGGTNNGLSYTYVAVPTVTSVVPDEGPVSGGTSVTVTGTGLTSTSQVTFDGNPAPFTVISDTALSAVTPPGAAGLVDVVVTNDAGSATATDAFTYLAGPGI GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 3->34|PLXA4_MOUSE|5e-04|56.2|32/100| SEG 35->71|satnvtnvspttvtavspsgsgsvgvtvttpggtsnp| SEG 84->107|tlsptsgstaggttvtitgtgfss| SEG 129->153|tavapagaagsvgvsvttaggtnng| SEG 174->194|vsggtsvtvtgtgltstsqvt| RP:PDB:NREP 1 RP:PDB:REP 195->244|2cxkB|6e-08|26.0|50/84| HM:PFM:NREP 3 HM:PFM:REP 3->76|PF01833|8.4e-17|48.6|74/85|TIG| HM:PFM:REP 84->158|PF01833|9.9e-19|44.0|75/85|TIG| HM:PFM:REP 162->241|PF01833|1.1e-20|38.8|80/85|TIG| RP:SCP:NREP 2 RP:SCP:REP 3->32|1a02N1|3e-04|30.0|30/102|b.1.18.1| RP:SCP:REP 195->241|1a47A1|2e-04|15.2|46/83|b.1.18.2| HM:SCP:REP 3->76|1pamA1|1.8e-12|47.2|72/0|b.1.18.2|1/3|E set domains| HM:SCP:REP 78->158|1pamA1|1.1e-16|53.2|79/0|b.1.18.2|2/3|E set domains| HM:SCP:REP 160->244|1d3cA1|7e-20|45.8|83/0|b.1.18.2|3/3|E set domains| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 34.0 SQ:SECSTR #################################################################################################################################################################ccccEEEccEEcTTcccEEEEEcccccccccEEETTEEEEcEEEETTEEEEEccccccEEEEEEEEETTEEccccEEEEEcccc## DISOP:02AL 246-248| PSIPRED ccEEcccccccccEEEEEEEcccccEEEEEEEEEEccEEEcccccEEEEEcccccccEEEEEEcccccccEEEEEEEcccEEEEEEcccccccccEEEEEEEcccccccEEEEccEEEEEEEEcccEEEEEcccccccEEEEEEEcccccccccEEEEccccEEEEEEcccccccccEEEEEEEEccccccEEEEccEEEEEEEEcccEEEEEEccccccEEEEEEEEccEEEEcccEEEEEccccc //