[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67768.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67768.1 GT:GENE BAC67768.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 69136..69402 GB:FROM 69136 GB:TO 69402 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67768.1 LENGTH 88 SQ:AASEQ MREENGEVMNKVKKVAAVAVMVGGMALGGGVAHASDGPDVVIPNLQVVDCQQEFEGGAAFLPIQGAAAVGDNSQNIGNFCTVVGPVED GT:EXON 1|1-88:0| TM:NTM 1 TM:REGION 15->37| SEG 8->32|vmnkvkkvaavavmvggmalgggva| OP:NHOMO 6 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------6------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccEEEcccccccccEEEcccHHHccccccccccccEEEEEccccc //