[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67769.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:171 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   115->145 PF06140 * Ifi-6-16 0.00082 35.5 31/83  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67769.1 GT:GENE BAC67769.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(70102..70617) GB:FROM 70102 GB:TO 70617 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67769.1 LENGTH 171 SQ:AASEQ MGSTDDARLQAVLSALWSAANVQGCFGQSDREPEEQDAVPCTVASLAEFGHLYGRVRLPTGQLVVCGCVAVRGGDESSDWLDLYVPVGALDHAGVAYWDGRPFFRSAATDDWLAAVGAEAFRSASFSLGVIGFEASGCTSASTMAGRLPEERDIGYLLPRGEVLHYGAANT GT:EXON 1|1-171:0| HM:PFM:NREP 1 HM:PFM:REP 115->145|PF06140|0.00082|35.5|31/83|Ifi-6-16| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 28-35, 170-171| PSIPRED ccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHEEEEcccccEEEEEEEEEccccccccEEEEEEEccccccccEEEEccccHHHcccccHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHcccccccccEEEcccccEEEcccccc //