[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67771.1
DDBJ      :             putative transmembrane transport protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:163 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->149 PF11234 * DUF3036 4.7e-43 28.8 146/155  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67771.1 GT:GENE BAC67771.1 GT:PRODUCT putative transmembrane transport protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 72189..72680 GB:FROM 72189 GB:TO 72680 GB:DIRECTION + GB:PRODUCT putative transmembrane transport protein GB:PROTEIN_ID BAC67771.1 LENGTH 163 SQ:AASEQ MGKLTVRALRAVLVVVLTGTLFVQAGMVWALVSGSDPEDGSLPLTPLRVITILGMVSVQVALVCVWRLVAMVRRGTVFSHAAFRYVDGVIGAIVAAALVWFAVTVINAPGQRDDPGVTVIMGGIGLAILGVALIVLVLRMLLAQAVARDVQAAHMQAELDEVI GT:EXON 1|1-163:0| TM:NTM 4 TM:REGION 11->33| TM:REGION 45->67| TM:REGION 81->103| TM:REGION 120->142| SEG 4->21|ltvralravlvvvltgtl| SEG 88->97|gvigaivaaa| SEG 119->138|vimggiglailgvalivlvl| HM:PFM:NREP 1 HM:PFM:REP 3->149|PF11234|4.7e-43|28.8|146/155|DUF3036| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----1----------------------------------------1-------11-----------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //