[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67772.1
DDBJ      :             putative transcriptional regulatory protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  189/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:73 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->69 3b7hA PDBj 3e-08 13.0 %
:RPS:SCOP  13->71 2ofyA1  a.35.1.3 * 3e-09 25.4 %
:HMM:SCOP  1->65 2a6cA1 a.35.1.13 * 1.2e-08 21.5 %
:HMM:PFM   13->62 PF01381 * HTH_3 4.2e-08 24.5 49/55  
:BLT:SWISS 1->72 YOZG_BACSU 1e-22 59.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67772.1 GT:GENE BAC67772.1 GT:PRODUCT putative transcriptional regulatory protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 72680..72901 GB:FROM 72680 GB:TO 72901 GB:DIRECTION + GB:PRODUCT putative transcriptional regulatory protein GB:NOTE PF01381: Helix-turn-helix GB:PROTEIN_ID BAC67772.1 LENGTH 73 SQ:AASEQ MPIAVDIDVMLARRKMSVGELADRVGITPANLAVLKNGRAKAVRFATLAALCEVLKCQPGDLLRWEAEDAAGG GT:EXON 1|1-73:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|YOZG_BACSU|1e-22|59.7|72/100| RP:PDB:NREP 1 RP:PDB:REP 1->69|3b7hA|3e-08|13.0|69/76| HM:PFM:NREP 1 HM:PFM:REP 13->62|PF01381|4.2e-08|24.5|49/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 13->71|2ofyA1|3e-09|25.4|59/82|a.35.1.3| HM:SCP:REP 1->65|2a6cA1|1.2e-08|21.5|65/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 231 OP:NHOMOORG 190 OP:PATTERN ---------------------------------------------1---------------------- -1--2--1111---------------------------------11---21--21------1--1-111------111--21------1111-------1-1-1-2---------------------------------------------------------------1-------------1--------1-1111121121212211-11-1112-1121-1111111-1---------------------11------1-11----1-----------1---1--------------------------211--1111--2111212222212111341---1--1---1--221---------1-------2331-------------1-111-------------1----------------------1121211-----1------------------------------------------------11-----------111---------111-111--1-------------1----------------------------1-------11-------1----------------------------------------11----1------1--21-1------1-12---------------11----------------------------------1--111-----------------1------------------------1-1---1112--------------------------------221211-----------11111111111111-------1--11-----------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 72 STR:RPRED 98.6 SQ:SECSTR HHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHcTTcccccHHHHHHHHHHHTccHHHHTccTTTTHHH# DISOP:02AL 69-73| PSIPRED ccEEEcHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHcEEEcccccccc //