[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67774.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67774.1 GT:GENE BAC67774.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 74098..74520 GB:FROM 74098 GB:TO 74520 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67774.1 LENGTH 140 SQ:AASEQ MTDDAYLFLLDDPAVPLGVPPSVAGELSCMDTPAVRAWLDAQGVTTTSPALRILPPEQTAAIPEQAERLPVPLSEAELSRLRHHNAPEAVARLEEELLAYRDCTDGRDTLLRRALAAGIPLARIVELTGEEPAAVAASSG GT:EXON 1|1-140:0| SEG 86->99|apeavarleeella| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 137-140| PSIPRED cccccEEEEEccccccccccHHHHHHHHccccHHHHHHHHHcccccccccEEEEcccHHHcccHHHccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHcccHHHHHcccc //