[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67778.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  15->78 2b20A2 c.69.1.2 * 0.00077 32.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67778.1 GT:GENE BAC67778.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 78733..78972 GB:FROM 78733 GB:TO 78972 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67778.1 LENGTH 79 SQ:AASEQ MATTHADALRSQRGIWIDAGTRDEWFLDLGALAFRDALTEAGVADDIVHFELFEGGHHAVEYRMPPALAWLAHRIADRP GT:EXON 1|1-79:0| HM:SCP:REP 15->78|2b20A2|0.00077|32.8|58/0|c.69.1.2|1/1|alpha/beta-Hydrolases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 78-79| PSIPRED cccccHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEccHHHHHHHHHHcccc //