[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67779.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67779.1 GT:GENE BAC67779.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(79005..79262) GB:FROM 79005 GB:TO 79262 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67779.1 LENGTH 85 SQ:AASEQ MNRSGSRDAFRSPDAQEVPSGGVDIPVRTETWTSSNTRFGAAPGRTGPHRAGLGPGALRKGRHRGGDPSESVLADLAGVCAERRY GT:EXON 1|1-85:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 59-69| PSIPRED cccccccccccccccccccccccccccccccccccccEEccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHcccc //