[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67787.1
DDBJ      :             putative IS982 family ISCef3-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:186 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->163 PF01609 * Transposase_11 1.5e-16 28.0 132/207  
:BLT:SWISS 4->88 Y1947_MYCTU 5e-04 34.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67787.1 GT:GENE BAC67787.1 GT:PRODUCT putative IS982 family ISCef3-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(87716..88276) GB:FROM 87716 GB:TO 88276 GB:DIRECTION - GB:PRODUCT putative IS982 family ISCef3-like transposase GB:NOTE IS607 family (87687..89851) Inverted repeat sequence (16/17 bp) Target sequence (CTAG). GB:PROTEIN_ID BAC67787.1 LENGTH 186 SQ:AASEQ MCGWSTPHRSAAVAPVRLAGWAQYGYCASHSRYFWGLRLHLVCTLGGLPVLFALTGADERETLRDMLDTAPDVLAAHPGQTIIGDKNYFGREFERGLAERHLKLLRPARKGEAELTGSHLFKPLRQVIESINQTFKGQLNLERHGGKSPAGVSARVLCRILALTAAIWHNDQTGQPIKRSLTAYGH GT:EXON 1|1-186:0| BL:SWS:NREP 1 BL:SWS:REP 4->88|Y1947_MYCTU|5e-04|34.6|78/303| HM:PFM:NREP 1 HM:PFM:REP 20->163|PF01609|1.5e-16|28.0|132/207|Transposase_11| OP:NHOMO 18 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------8----------------------------------------------------------12----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 183-186| PSIPRED ccccccccHHEEEccccccccccEEEcccccEEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHcccEEEcccccccccccccHHHHccccEEEcHHHHHHHHHccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcc //