[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67789.1
DDBJ      :             putative rRNA methyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  175/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:111 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->108 1p91B PDBj 6e-11 39.5 %
:RPS:PDB   7->108 3b5iB PDBj 4e-12 13.0 %
:RPS:SCOP  16->109 1p91A  c.66.1.33 * 1e-18 37.2 %
:HMM:SCOP  18->109 1p91A_ c.66.1.33 * 1.1e-10 26.1 %
:HMM:PFM   87->107 PF05175 * MTS 0.00027 47.6 21/170  
:BLT:SWISS 18->108 RRMA_ECOLI 2e-12 37.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67789.1 GT:GENE BAC67789.1 GT:PRODUCT putative rRNA methyltransferase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(89844..90179) GB:FROM 89844 GB:TO 90179 GB:DIRECTION - GB:PRODUCT putative rRNA methyltransferase GB:NOTE mycinamicin resistance protein homolog GB:PROTEIN_ID BAC67789.1 LENGTH 111 SQ:AASEQ MPVSLSPALEPFLDLLRCPTCRTGLHLGHGALRCPAGHTFDIARHGYVSLLTGTRATSGDDAAMARARDRFLSTGSYGPIRQAVARLAADAMPEQGTVLDVGCGTGYYLDD GT:EXON 1|1-111:0| BL:SWS:NREP 1 BL:SWS:REP 18->108|RRMA_ECOLI|2e-12|37.4|91/269| SEG 60->70|ddaamarardr| BL:PDB:NREP 1 BL:PDB:REP 18->108|1p91B|6e-11|39.5|81/251| RP:PDB:NREP 1 RP:PDB:REP 7->108|3b5iB|4e-12|13.0|100/340| HM:PFM:NREP 1 HM:PFM:REP 87->107|PF05175|0.00027|47.6|21/170|MTS| RP:SCP:NREP 1 RP:SCP:REP 16->109|1p91A|1e-18|37.2|94/269|c.66.1.33| HM:SCP:REP 18->109|1p91A_|1.1e-10|26.1|92/268|c.66.1.33|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 176 OP:NHOMOORG 175 OP:PATTERN -------------------------------------------------------------------- ------------1-----------------------1111--11--1---1---1--1--------12--1--------------------------------------------------------------------------------------------------------------------------1--------------------1------1-------------------------------------------------------11-1-----1--11111111111-------------1111111111----1----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1------------------------111------------------------------------1--11-111111-11111--111-1--------------11111111111111111-1111111111111111111111--1111-11111111-11111111111111-111111111111---------------------------------1111111---------1111-1111--11----------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 92.8 SQ:SECSTR ######HHHHHHHHTcccccccccccEEEEEETcccccHHHHHHHHHHHHHHHHHHHTTcccccEEEEEEEcTTccHHHHHHHccccccccccTccccEEEEEEccTTH## DISOP:02AL 1-4, 110-111| PSIPRED cccccHHHHHHHHHHHcccccccccEEcccEEEcccccEEccccccEEEEcccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEEEccccccccc //