[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67790.1
DDBJ      :             putative oligosaccharide deacetylase, secreted
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  339/915 : Eukaryota  50/199 : Viruses  0/175   --->[See Alignment]
c.6.2
:256 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   72->251 2c1gA PDBj 2e-24 36.6 %
:RPS:PDB   72->252 2cc0A PDBj 7e-30 32.2 %
:RPS:SCOP  72->252 1ny1A  c.6.2.3 * 1e-43 26.6 %
:HMM:SCOP  57->251 2iw0A1 c.6.2.3 * 7.7e-47 36.8 %
:RPS:PFM   70->174 PF01522 * Polysacc_deac_1 5e-15 38.2 %
:HMM:PFM   68->188 PF01522 * Polysacc_deac_1 6.7e-29 33.1 118/124  
:BLT:SWISS 65->249 NODB_RHISN 2e-30 38.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67790.1 GT:GENE BAC67790.1 GT:PRODUCT putative oligosaccharide deacetylase, secreted GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(90422..91192) GB:FROM 90422 GB:TO 91192 GB:DIRECTION - GB:PRODUCT putative oligosaccharide deacetylase, secreted GB:NOTE PF01522: Polysaccharide deacetylase GB:PROTEIN_ID BAC67790.1 LENGTH 256 SQ:AASEQ MARHGGRGWYGRVLAAAVGVTALAAATSVWTAQAGPVDGQHSARPAAPGSGTGRAPVSADIAHASDHGAQGVNITIDDGPDPIWTPQVLQVLRENGVKATFCMVGTQAQAHPDLVKAVVAAGHRLCDHTVSHDTTMDTKSHSYQSRQILDAERMITKASGGVRPLYYRAPGGAFTPYSRHLAASRGMRPLGWNADSKDFERPGADAISATVKNEIPHGPTILFHDAGGDRSQTVAALRELLPWLKQQGYSFGFPVR GT:EXON 1|1-256:0| BL:SWS:NREP 1 BL:SWS:REP 65->249|NODB_RHISN|2e-30|38.6|184/215| TM:NTM 1 TM:REGION 9->31| SEG 13->27|vlaaavgvtalaaat| BL:PDB:NREP 1 BL:PDB:REP 72->251|2c1gA|2e-24|36.6|172/384| RP:PDB:NREP 1 RP:PDB:REP 72->252|2cc0A|7e-30|32.2|174/192| RP:PFM:NREP 1 RP:PFM:REP 70->174|PF01522|5e-15|38.2|102/123|Polysacc_deac_1| HM:PFM:NREP 1 HM:PFM:REP 68->188|PF01522|6.7e-29|33.1|118/124|Polysacc_deac_1| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 1 RP:SCP:REP 72->252|1ny1A|1e-43|26.6|177/235|c.6.2.3| HM:SCP:REP 57->251|2iw0A1|7.7e-47|36.8|190/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 977 OP:NHOMOORG 391 OP:PATTERN -----1--------------------------------------------1----------------- 232-511-------21111-11111111111111111--11222-1--1---22------2241-1-6853-222----2111-----1112-111----1221-222-1--------------------------12212111--312122-22--------1-113352------------242111--555A9A9AABA8AAABC9665575AAC54675231111119B--------------------2-1-11---------111-----1111111111111111111111111111111111111111---111124579666666655549775333543-141152446533343322321--2--1--------1154432334443--------------1--2---11-111-2211221143----1------1--------------1----------------------------1-1--11-1-----1111-2-------12------111111---111-1----1111-1-11--------------11112-------1--111--1-------11---1---------------------------11------1----------------------1-------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------11122222222222---------------------------------------------------1-1111-1 ------------BB211--2-1-1221------2-2-1-1111---1-121212113---111--------------------------221142-1111131D67-----------------------------------------------------------------------------------2----11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 85.2 SQ:SECSTR #################################TccccE##EcEEEEccEEEEEEEccHEEEEETEEccccEEEEEEccccTTTHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEccccccccGGGccHHHHHHHHHHHHHHHHHTTccccccEEccGGGcccHHHHHHHHHTTcEEccccEEccGGGTccHHHHHHHHHHTccTTcEEEEEcTccccHHHHHHHHHHHHHHHHTTEEEcG### DISOP:02AL 1-4| PSIPRED cccccccccHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHccccEEEEEEHHHHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHHHcccEEccccc //