[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67792.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->65 PF07020 * Orthopox_C10L 0.00056 34.0 47/83  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67792.1 GT:GENE BAC67792.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 92523..92741 GB:FROM 92523 GB:TO 92741 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67792.1 LENGTH 72 SQ:AASEQ MTEPDGRPAGVRLCSSGGGAGAGQMCRSRCSVCVATGTGGVCLTAAARSGKAGQQGSSAGICMGIDLACLLL GT:EXON 1|1-72:0| SEG 45->60|aaarsgkagqqgssag| HM:PFM:NREP 1 HM:PFM:REP 3->65|PF07020|0.00056|34.0|47/83|Orthopox_C10L| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 51-52| PSIPRED cccccccEEEEEEEcccccccccEEEEEEEEEEEccccccEEEEEEHHcccccccccEEEEEEEccHHHHcc //