[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67794.1
DDBJ      :             putative MerR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->116 1q06B PDBj 9e-07 34.1 %
:BLT:PDB   142->206 1q06B PDBj 4e-05 30.8 %
:RPS:PDB   9->112 3d70A PDBj 3e-07 19.3 %
:RPS:PDB   142->207 3d70A PDBj 2e-12 25.8 %
:RPS:SCOP  10->107 1jbgA  a.6.1.3 * 2e-05 15.7 %
:RPS:SCOP  142->203 1j9iA  a.6.1.5 * 5e-11 19.4 %
:HMM:SCOP  10->115 1jbgA_ a.6.1.3 * 7e-10 27.2 %
:HMM:SCOP  139->248 1jbgA_ a.6.1.3 * 1e-14 33.7 %
:HMM:PFM   15->49 PF00376 * MerR 4.5e-11 40.0 35/38  
:HMM:PFM   142->178 PF00376 * MerR 4e-12 45.9 37/38  
:HMM:PFM   119->137 PF04360 * Serglycin 0.00017 63.2 19/150  
:HMM:PFM   61->114 PF11740 * KfrA_N 0.00083 18.5 54/120  
:BLT:SWISS 15->116 CUER_SHIFL 3e-06 35.2 %
:BLT:SWISS 142->207 Y293_HAEIN 7e-07 34.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67794.1 GT:GENE BAC67794.1 GT:PRODUCT putative MerR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 94242..95009 GB:FROM 94242 GB:TO 95009 GB:DIRECTION + GB:PRODUCT putative MerR-family transcriptional regulator GB:NOTE PF00376: MerR-family regulatory protein GB:PROTEIN_ID BAC67794.1 LENGTH 255 SQ:AASEQ MGRNLQSGERLRPVDLARGHGLSTQAVRNYEEAGILPAAGRTPHGYRTYTSLHAGALRAFLALVPGHGHRTAASIMRAVNEGAVDEALRLIDESHAQLLDDRRTLQAVESALRDLEPTTGSGPGGGSGPAAGSGSGSGGTFIGPLAHKLGIRPATLRTWERAGLVRPRRDPLTGYRVYDEADVRDARLAHQLRRGGYLLEQIAPLIARVRAAGGLEPLEAALRDWHGRLSARGRALLAGAAGLEAYLHERRKTRS GT:EXON 1|1-255:0| BL:SWS:NREP 2 BL:SWS:REP 15->116|CUER_SHIFL|3e-06|35.2|91/135| BL:SWS:REP 142->207|Y293_HAEIN|7e-07|34.8|66/128| SEG 120->139|gsgpgggsgpaagsgsgsgg| SEG 211->222|aagglepleaal| SEG 227->243|grlsargrallagaagl| BL:PDB:NREP 2 BL:PDB:REP 15->116|1q06B|9e-07|34.1|91/126| BL:PDB:REP 142->206|1q06B|4e-05|30.8|65/126| RP:PDB:NREP 2 RP:PDB:REP 9->112|3d70A|3e-07|19.3|104/276| RP:PDB:REP 142->207|3d70A|2e-12|25.8|66/276| HM:PFM:NREP 4 HM:PFM:REP 15->49|PF00376|4.5e-11|40.0|35/38|MerR| HM:PFM:REP 142->178|PF00376|4e-12|45.9|37/38|MerR| HM:PFM:REP 119->137|PF04360|0.00017|63.2|19/150|Serglycin| HM:PFM:REP 61->114|PF11740|0.00083|18.5|54/120|KfrA_N| RP:SCP:NREP 2 RP:SCP:REP 10->107|1jbgA|2e-05|15.7|98/106|a.6.1.3| RP:SCP:REP 142->203|1j9iA|5e-11|19.4|62/68|a.6.1.5| HM:SCP:REP 10->115|1jbgA_|7e-10|27.2|103/106|a.6.1.3|1/2|Putative DNA-binding domain| HM:SCP:REP 139->248|1jbgA_|1e-14|33.7|104/106|a.6.1.3|2/2|Putative DNA-binding domain| OP:NHOMO 19 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ----1-------------------------------2111-----1--------------11--1-1111--------------------------------------------------------------------------1----------------------------------------------------------------1---------------------2------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 69.4 SQ:SECSTR ########ccEEHHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHccHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#########################HHHHHHHHTccHHHHHHHHHTTccccEEcTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTHHH############################################# DISOP:02AL 1-8, 113-137, 253-255| PSIPRED ccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //