[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67796.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->82 PF10809 * DUF2732 5.5e-05 38.2 34/77  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67796.1 GT:GENE BAC67796.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 96235..96567 GB:FROM 96235 GB:TO 96567 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67796.1 LENGTH 110 SQ:AASEQ MPVCWDGRGMYLVHIHLEFPPRTQLPFGARDMIRAALTADDLVEHVAVHPRSPSRLTLGFYLLAARLEEAEERAARVSRRLAEDVPVLRGARLRGAGVPLVPLAFERTPG GT:EXON 1|1-110:0| SEG 62->83|llaarleeaeeraarvsrrlae| HM:PFM:NREP 1 HM:PFM:REP 49->82|PF10809|5.5e-05|38.2|34/77|DUF2732| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 109-110| PSIPRED ccEEEccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccEEEEEEccccc //