[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67800.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  38/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->76 PF01844 * HNH 0.00034 34.9 43/52  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67800.1 GT:GENE BAC67800.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 101447..101893 GB:FROM 101447 GB:TO 101893 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67800.1 LENGTH 148 SQ:AASEQ MLEAAQGAPASSGRRTRRPGLSEEVLRAYAYACAFCGYDGMLGRNPVGLEAAHIRWHSQDGPDTLANALALCALHHILFGLGVLGLSPGLRIQVSPLYVARSHAGHAVGILHRRPLAPPRPGHPSPGPEHIHWHHQQVFKHAPTPVAR GT:EXON 1|1-148:0| SEG 65->74|lanalalcal| SEG 111->128|lhrrplapprpghpspgp| HM:PFM:NREP 1 HM:PFM:REP 33->76|PF01844|0.00034|34.9|43/52|HNH| OP:NHOMO 38 OP:NHOMOORG 38 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------1-1--------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------1--------------------1-1--11--11111-1---11--111-------111----11-1-1--1-1111-111-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 147-148| PSIPRED ccHHHccccHHccEEEccHHHHHHHHHHHcccccEEccEEEEccccEEEEEEEccccccccccccccHHHHHHHHHHHHccccEEEccccEEEEEcccccccccHHHHHHccccEEcccccccccccHHHHHHHHHHHHHHccccccc //