[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67804.1
DDBJ      :             putative secreted protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
:512 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   235->253 PF08309 * LVIVD 0.00041 47.4 19/42  
:HMM:PFM   15->52 PF05887 * Trypan_PARP 0.001 43.2 37/143  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67804.1 GT:GENE BAC67804.1 GT:PRODUCT putative secreted protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 104696..106234 GB:FROM 104696 GB:TO 106234 GB:DIRECTION + GB:PRODUCT putative secreted protein GB:PROTEIN_ID BAC67804.1 LENGTH 512 SQ:AASEQ MLRSPDGRVRVALIRTLRPLAVLAATAALFAGITDLPAAADGTAVTKLTLGTDQFKMTDTNYESATNNLYNNVLTNHANLTDVVTTDYTKNSSGATDAWMNLRSMRACAGSETQALPPVNKKVAWCWSSAHADDTTPRWFPQGMSTTGTADGGDGAIQGKHVSAVAWHYKTFKTNSAGDLEANDGCKTNNLLKVSFIDRDTGKYRHVLLAEPTSTSSSASNFKFVTGHGGGIVWYANYLYVTDTANGIRVFDINKLAKVDTYGSGLNSYGVSGGNSSACGYPYVLPEVHYYKQASTPASCSTNAVDGTPDADALCYSWLSLDKTGAGPFKLVTGEWYGNVAGGRVVRYQLNPTSASAYPGLLNMSGGKTVIQDAYAASGYQGLQGGMTWTDDAGLLNFAFSKGCGTKPAVFSHTWAGDTRAVTSCAAGGNWAVGSPQALSYWPKLDTAQVDELWGLTEGICAGTSLRASYPYEFPAVSESGNACTGYNSSDNLSLRSVFAVGFTDPAVQNLH GT:EXON 1|1-512:0| SEG 17->31|lrplavlaataalfa| SEG 146->156|ttgtadggdga| HM:PFM:NREP 2 HM:PFM:REP 235->253|PF08309|0.00041|47.4|19/42|LVIVD| HM:PFM:REP 15->52|PF05887|0.001|43.2|37/143|Trypan_PARP| OP:NHOMO 24 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------1-------------------122-------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------121---211-1111-----------------------1111---1-------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 511-512| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccEEEEcccccHHHHHHHHHHHcccccccccEEEccccccccccHHHHHHHHHHHHccccHHccccccccEEEEEccccccccccccccccccccccccccccEEEcEEEEEEEEEccccccccccccccccccccccEEEEEEEEcccccEEEEEEEEEcccccccHHccEEEcccEEEEEEccEEEEEEcccEEEEEEEEEEEEEEccccccccccccccccccccccEEcccEEEEEcccccccccccccccccccccEEEEEEEEEcccccccEEEEEEEEccccccEEEEEEEccccccccccccccccccEEHHHHHHHHHcccccccEEEEcccccHHccccccccccccEEEEEccccccccccccccccccccccHHHEEcccccccccHHHHccHHHHHcccccccccccccccccccccEEEccccccccEEEEEEEEccccHHHHccc //