[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67806.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:178 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67806.1 GT:GENE BAC67806.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(107491..108027) GB:FROM 107491 GB:TO 108027 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67806.1 LENGTH 178 SQ:AASEQ MLSDLSPVIAASARWLLSAFPPAAGPLNDALAEAQAQHAATIAAALRYPTALDAELLNLLGPGGSGALDHVTGAAAHPLTDAAPAWRTQVDETVVSWAACLLADPALAAVAAACLAATHHGANGVGDARRLTIPSPRDHRAAPLLRHPDLLGPIADLHRESLLGLLHPGPALTSPGHR GT:EXON 1|1-178:0| SEG 30->45|alaeaqaqhaatiaaa| SEG 74->85|aaahpltdaapa| SEG 98->117|aaclladpalaavaaaclaa| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 172-178| PSIPRED cccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccc //