Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67811.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:117 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67811.1 GT:GENE BAC67811.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(118868..119221) GB:FROM 118868 GB:TO 119221 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67811.1 LENGTH 117 SQ:AASEQ MTSRHGTTTLWRPTGPKELDLVRELKWRAWPARLLGQPFFYPVLNEDYAVKIARDWNVKHDGAGFVTRFEVESQFLRRYPVRQAGGQTILELWVPAAELDDFNAHMAGEIEVVHEFR GT:EXON 1|1-117:0| OP:NHOMO 19 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------12--1--11------------------------------------1--------------------------------------1------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---------11-----------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccEEEEEcccHHHHHHHHHcccccccccccccccEEEEccHHHHHHHHHccccccccccEEEEHHHHHHHHHHcccccccccEEHEEEcccccHHHHHHHHHHHHHHHEEcc //