[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67814.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   46->60 PF08271 * TF_Zn_Ribbon 3.4e-05 40.0 15/43  
:HMM:PFM   5->25 PF11142 * DUF2917 0.00044 28.6 21/63  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67814.1 GT:GENE BAC67814.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(121935..122162) GB:FROM 121935 GB:TO 122162 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67814.1 LENGTH 75 SQ:AASEQ MASKPVRASLGEVWLTCQICRGDLFRERGVLLNSTGMEFMKLAWADENATGLICWRCGYVHLFVNKDIKLYRADK GT:EXON 1|1-75:0| HM:PFM:NREP 2 HM:PFM:REP 46->60|PF08271|3.4e-05|40.0|15/43|TF_Zn_Ribbon| HM:PFM:REP 5->25|PF11142|0.00044|28.6|21/63|DUF2917| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 74-75| PSIPRED ccccccccccccEEEEEEcccccEEHHcccEEEccccEEEEEEEcccccEEEEEccccEEEEEEcccEEEEEccc //