[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67815.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:187 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->101 PF07336 * DUF1470 0.00018 23.0 61/132  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67815.1 GT:GENE BAC67815.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 123637..124200 GB:FROM 123637 GB:TO 124200 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67815.1 LENGTH 187 SQ:AASEQ MFSKRLIAAAATAVVIAGLGACGSETGNGSGSGGADLGSSWSDDAGRSGQDAAPHARPDTDTVRGLRDSVRHLSRKTAKATRPHLVNKCTPATRRAKHTQQRGTGTRKKTRTWYTTEHYQDCKKVRNGTETYTRTVRPQQWCVRLDDVDGDTSQDDRWYQVTRTTYDEALTMAEHTRIEFTPAGTGC GT:EXON 1|1-187:0| SEG 6->21|liaaaatavviaglga| SEG 23->46|gsetgngsgsggadlgsswsddag| SEG 99->112|tqqrgtgtrkktrt| HM:PFM:NREP 1 HM:PFM:REP 40->101|PF07336|0.00018|23.0|61/132|DUF1470| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 24-55, 95-107| PSIPRED cccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHcccccccccEEEcHHHHHHHHHHHccHHHHHHccccHHHEEEEccccccccccccEEEHHHHHHHHHHHHHHHcEEEEccccccc //