[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67816.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  157/915 : Eukaryota  41/199 : Viruses  0/175   --->[See Alignment]
a.102.1
:108 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   21->108 2eacB PDBj 1e-05 6.8 %
:RPS:SCOP  1->105 2nvpA1  a.102.1.8 * 7e-08 14.3 %
:HMM:SCOP  2->105 1gaiA_ a.102.1.1 * 2.1e-13 35.4 %
:HMM:PFM   1->107 PF00723 * Glyco_hydro_15 6.6e-19 21.5 107/448  
:BLT:SWISS 1->105 YAY3_SCHPO 4e-14 28.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67816.1 GT:GENE BAC67816.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 124557..124883 GB:FROM 124557 GB:TO 124883 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67816.1 LENGTH 108 SQ:AASEQ MQLDVYGYVVETLYLAHQSGVARCGDTAVLHQRLVEHLAERWQMPDEGIWEVRGERRHFVHSKVMAWAVVDRTIRLVEAGALDAGLCALMELREAIRHEVCTRGFEPV GT:EXON 1|1-108:0| BL:SWS:NREP 1 BL:SWS:REP 1->105|YAY3_SCHPO|4e-14|28.6|105/100| RP:PDB:NREP 1 RP:PDB:REP 21->108|2eacB|1e-05|6.8|88/885| HM:PFM:NREP 1 HM:PFM:REP 1->107|PF00723|6.6e-19|21.5|107/448|Glyco_hydro_15| RP:SCP:NREP 1 RP:SCP:REP 1->105|2nvpA1|7e-08|14.3|105/426|a.102.1.8| HM:SCP:REP 2->105|1gaiA_|2.1e-13|35.4|99/0|a.102.1.1|1/1|Six-hairpin glycosidases| OP:NHOMO 267 OP:NHOMOORG 203 OP:PATTERN ------2--------1---------------------------------------------111---- 1-112--1111---21111-11--11111111111132221433111111-12311-1--434-1-35422-----------2--------1-1---------111--1----------------1----1--1-1---------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11122111111------------11111111-----------121-------------------------111-1------------------------------------------1211212111112231111111122-1----111--1-----1--------------------1--------1----------1-------221233--------------------------------------------------------------2----------1----------------------------------------------------------------------------------------------------------------------------------1111-111--212--------------------------11111111------------------------------------------------------------11- ----11--------1---1-222111---------------------111111111111111------------------------11--11--1111111--111---1-------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 82.4 SQ:SECSTR ###################HHHHHHHHHTcEEccGGGcccEEccEEEETTEEEEEEEccHHHHHHHHHHHHHHHHHHHHTTcTTcccccTTccGGGGcccTTcccccT PSIPRED cccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccc //