[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67817.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.102.1
:139 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   65->113 1agmA PDBj 3e-08 18.4 %
:RPS:SCOP  1->113 2nvpA1  a.102.1.8 * 1e-08 7.6 %
:HMM:SCOP  1->124 1ug9A1 a.102.1.5 * 4.2e-11 38.7 %
:HMM:PFM   75->113 PF00723 * Glyco_hydro_15 6.3e-07 23.1 39/448  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67817.1 GT:GENE BAC67817.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 124945..125364 GB:FROM 124945 GB:TO 125364 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67817.1 LENGTH 139 SQ:AASEQ MGFLSPGGPRVLGTVEAVRRQPATLEGFVRRYPTAGDHAGLDGLDGDEGGLPALLVVDGRRARSDRPPGQAHGLFGRFLALRTDLGLLAEEYDHVTGWQLGNFPQAYSHIGVIGSALLLQQLGSGAPAAEAEVLLAADV GT:EXON 1|1-139:0| SEG 35->55|agdhagldgldgdegglpall| SEG 114->137|gsalllqqlgsgapaaeaevllaa| RP:PDB:NREP 1 RP:PDB:REP 65->113|1agmA|3e-08|18.4|49/470| HM:PFM:NREP 1 HM:PFM:REP 75->113|PF00723|6.3e-07|23.1|39/448|Glyco_hydro_15| RP:SCP:NREP 1 RP:SCP:REP 1->113|2nvpA1|1e-08|7.6|105/426|a.102.1.8| HM:SCP:REP 1->124|1ug9A1|4.2e-11|38.7|119/0|a.102.1.5|1/1|Six-hairpin glycosidases| OP:NHOMO 44 OP:NHOMOORG 42 OP:PATTERN -------------------------------------------------------------------- 1----------------------------------------1111111-------------11---1221---------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------111111-1-----------1---------------------------1---1--------------------------------------------------1111--11111111--1------1-------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 81.3 SQ:SECSTR TTcccHHHHHHHHHHHTcTTTTccccccccccTTcTTccTTcTTTTcEEHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHccTTcccccEEcTTTccEEcccccHHHHHHHH########################## PSIPRED ccccccccHHHHHHHHHHHHHcccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccc //