[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67823.1
DDBJ      :             putative IS701 family ISSus1-like transposase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 3->141 T701_FREDI 3e-07 27.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67823.1 GT:GENE BAC67823.1 GT:PRODUCT putative IS701 family ISSus1-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 132479..133000 GB:FROM 132479 GB:TO 133000 GB:DIRECTION + GB:PRODUCT putative IS701 family ISSus1-like transposase GB:NOTE IS701 family (131931..133947). Inverted repeat sequence (21/27 bp). Target sequence (GC). GB:PROTEIN_ID BAC67823.1 LENGTH 173 SQ:AASEQ MRGLMLDGRRKSIQAMAARLPDGNEQNLQQFVNQSTWDPVPVQRRIAERMLPLINPVAWVIDDVSVPKDERMSVAVAPQYCGALGKRANCQVAVTVHAATDTASCPLQWRLFLPKEWASDTDRRAITRIPPEVAQALSRWLTGWDDLLVDQAGRGRPWGARRRRTGGTGTRSR GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 3->141|T701_FREDI|3e-07|27.2|136/100| SEG 92->103|vavtvhaatdta| SEG 153->172|grgrpwgarrrrtggtgtrs| OP:NHOMO 279 OP:NHOMOORG 37 OP:PATTERN ------------------------------1--------------------2---------------- --1----1------1-----------------------4---31----------------------26111----------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A-----------4-13---------------------1---1--3--------------11---------------------2----1--------------------------------------------------------2--------1--------7---1--51----------------------------------------------6------6-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-------------------------------------------------uu*--------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7, 161-173| PSIPRED ccccccccccccHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEccccccccHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccc //