[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67824.1
DDBJ      :             putative IS6 family ISRH1-like transposase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  125/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.55.3d.92.1
:239 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  8->68 1xm5A  d.92.1.15 * 2e-11 22.6 %
:HMM:SCOP  65->212 1c0mA2 c.55.3.2 * 1.1e-05 17.8 %
:RPS:PFM   9->105 PF03050 * Transposase_25 2e-16 42.7 %
:HMM:PFM   10->144 PF03050 * Transposase_25 7.5e-18 19.5 128/178  
:BLT:SWISS 8->207 T431_STAAW 4e-18 26.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67824.1 GT:GENE BAC67824.1 GT:PRODUCT putative IS6 family ISRH1-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 132949..133668 GB:FROM 132949 GB:TO 133668 GB:DIRECTION + GB:PRODUCT putative IS6 family ISRH1-like transposase GB:NOTE IS701 family (131931..133947). Inverted repeat sequence (21/27 bp). Target sequence (GC). GB:PROTEIN_ID BAC67824.1 LENGTH 239 SQ:AASEQ MGSTSPSYRGHRYPVEVISHCMWLYFRFPLSFREVEELMLQRGVIVSYETVRRWCAKFGQAYANGLRRRRPRPGDKWHLDEVFVRVNGELKYLWRAVDQDGNVLDILVQNRRDKAAARRFFRRLMKETRSVPRVVVTDKLRSYGAAHREVMPSVEHRSHKGLNNRAENSHQPTRQRERAMKGFRSTGGAQRFLSAFSGISPHFRPHRHLMTASDHRAEMTIRFAIWDQITGAASRPTTA GT:EXON 1|1-239:0| BL:SWS:NREP 1 BL:SWS:REP 8->207|T431_STAAW|4e-18|26.5|196/224| SEG 111->123|rrdkaaarrffrr| RP:PFM:NREP 1 RP:PFM:REP 9->105|PF03050|2e-16|42.7|96/160|Transposase_25| HM:PFM:NREP 1 HM:PFM:REP 10->144|PF03050|7.5e-18|19.5|128/178|Transposase_25| RP:SCP:NREP 1 RP:SCP:REP 8->68|1xm5A|2e-11|22.6|53/152|d.92.1.15| HM:SCP:REP 65->212|1c0mA2|1.1e-05|17.8|146/0|c.55.3.2|1/1|Ribonuclease H-like| OP:NHOMO 475 OP:NHOMOORG 130 OP:PATTERN ---------------------------------------------------1--------------1- --3---22334--2------------------------2--298-----------------------1----------------------------5---------------------------------------------1---1-------------------1-----------------9--------------11-1--------------5-------9-------26214-12-5552-4-38788---24-1-------1-----1--C3-------------------------------------3244-------------------------9-1---------------B--11---------11------1-B----------22212221229---7--E2-28--7--J---F-------131------1----------4-1------------------------------------61-------------8----22-12114--------2------------3-------------------------------------------------------------------------------------------------112------1-3--1---------------------------1-2------29---2---4------E1-----------A--3--3---A------------------------1------------------------------3-3-3---------2------------------------1--7--------------4-----11----1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------6--------------------------2-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 234-239| PSIPRED ccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccEEEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEEccccccEEccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccc //