[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67825.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67825.1 GT:GENE BAC67825.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 133696..134031 GB:FROM 133696 GB:TO 134031 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67825.1 LENGTH 111 SQ:AASEQ MPRRTIRQSRTQQRDNALPGVPRRWRVRRRSVPVVEPPSEPDTHAILSVFTSHVLDMLPWDSQVTFAGVELACRGQVGWVAHRLACVRRAGGCSSPLAGSSPRTLSSSLAF GT:EXON 1|1-111:0| SEG 3->14|rrtirqsrtqqr| SEG 21->41|vprrwrvrrrsvpvveppsep| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18| PSIPRED cccHHHHHHHHHHHccccccccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccEEEccEEEEEcccHHHHHHHHHHHHHccccccccccccccccHHcccc //