[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67827.1
DDBJ      :             putative IS5 family IS1647-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 4->118 YI22_BURCE 6e-14 33.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67827.1 GT:GENE BAC67827.1 GT:PRODUCT putative IS5 family IS1647-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 136682..137041 GB:FROM 136682 GB:TO 137041 GB:DIRECTION + GB:PRODUCT putative IS5 family IS1647-like transposase GB:NOTE IS5 family (136639..137502) Inverted repeat sequence (18/24 bp). GB:PROTEIN_ID BAC67827.1 LENGTH 119 SQ:AASEQ MTDLVERLVPDELWVLFRRVVPPTEVIRPQGGGRRRAGDREALAAIIFVATSGCTWRQLPPVFGPSWQTVYRRFAQWSRARVWARLHRVILDELGARGELDWSRCAIDSVSLRAAKGGH GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 4->118|YI22_BURCE|6e-14|33.0|115/100| SEG 31->45|gggrrragdrealaa| OP:NHOMO 99 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ------------------------------------3-33------------------------1-C63---------------------------------------1----------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------1-----------------------------------------------------------------------------------------18-14-----31-------1B---------6--3--9------------------------1-------------------------------1---------------------------------------------------------------------------3-----------------------------------------------------------123--2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 27-31, 117-119| PSIPRED ccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccHHHcccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHEEEEcccccccccccc //