[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67828.2
DDBJ      :             putative IS5 family IS1647-like transposase
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.3.1
:214 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  77->214 2ebfX3  d.3.1.17 * 3e-12 9.0 %
:HMM:PFM   69->200 PF01609 * Transposase_11 9.6e-20 32.0 122/207  
:BLT:SWISS 64->214 T402_BURCE 5e-25 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67828.2 GT:GENE BAC67828.2 GT:PRODUCT putative IS5 family IS1647-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 136846..137490 GB:FROM 136846 GB:TO 137490 GB:DIRECTION + GB:PRODUCT putative IS5 family IS1647-like transposase GB:NOTE IS5 family (136639..137502) Inverted repeat sequence (18/24 bp). Translation will be controlled by frameshift with SAV118. GB:PROTEIN_ID BAC67828.2 LENGTH 214 SQ:AASEQ MAAAAAGVRPELADGLPTLRPMEPGPCLGPAPPRHPRRTRCPRRVGLVTVRDRLGQPAGGKRGPLTGPNPTDRGKLGSKIHLITDRNGLPLSLGISGANMHDSLGLEPLVRGIPPIRSRRGPRRRRPGKLHADKGYDYDHLRRWLRKRGIRHRIARKGIESSKRLGRHRWVVERTVSWLAGCRRLHRRYERKAEHCLAFADIAAALICHRRLTK GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 64->214|T402_BURCE|5e-25|38.4|151/211| SEG 30->44|papprhprrtrcprr| SEG 111->128|rgippirsrrgprrrrpg| HM:PFM:NREP 1 HM:PFM:REP 69->200|PF01609|9.6e-20|32.0|122/207|Transposase_11| RP:SCP:NREP 1 RP:SCP:REP 77->214|2ebfX3|3e-12|9.0|122/192|d.3.1.17| OP:NHOMO 183 OP:NHOMOORG 48 OP:PATTERN --------------------------------------------------411--------------- ----3--1--1-------------------------1-23--4------------1---------1P413------------1------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------2----------------------311----1-1---------------------------------------------------------------------------------------18--Y----2411-------C7-3------6--5--9-1----------1-----------1-----------2------------------12---------------------------------------------------------------------------4-----------------------------------------------------------3----------------------------------5-----------------------------------------------------------------2----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 50-69| PSIPRED cccEEEEEccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccEEEEcccccHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHHHHcc //