[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67830.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.142.1
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   99->134 2de0X PDBj 4e-04 5.6 %
:HMM:SCOP  23->134 1gsaA2 d.142.1.1 * 8.2e-07 23.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67830.1 GT:GENE BAC67830.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 138932..139393 GB:FROM 138932 GB:TO 139393 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67830.1 LENGTH 153 SQ:AASEQ MFVESGHHWSLRPRAPGFAGERLFQQRVSKSADIRLTAVGDHLTAVRIDGSPGIDWRRHYEALTYTPVPVPPEITKGVRAYLDAFGLVFGAFDFGLGTDGRWHWYECNPNGQWAWFPDNITAPITNALADRLQHPQGTFQSCCQAALVTGGEV GT:EXON 1|1-153:0| RP:PDB:NREP 1 RP:PDB:REP 99->134|2de0X|4e-04|5.6|36/460| HM:SCP:REP 23->134|1gsaA2|8.2e-07|23.4|107/192|d.142.1.1|1/1|Glutathione synthetase ATP-binding domain-like| OP:NHOMO 23 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------21--1--22-1-------------------------------------------------------------------------1-------1--------------211-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1-----------------------------------------1-----------------------------------------------------------------------------------------------------------------1------1-----------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 36 STR:RPRED 23.5 SQ:SECSTR ##################################################################################################cccEEEEEETTTTEEEEEEGGGEEEcccEEcccccc################### DISOP:02AL 1-4, 152-153| PSIPRED cEEccccEEEEEEccccccccEEEEEEEccccEEEEEEEccEEEEEEEEcccccccccccccccEEEEEccHHHHHHHHHHHHHHcccEEEEEEEEEcccEEEEEEEccccccccccccccccHHHHHHHHHHcccccHHHHHHHHHHccccc //