[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67831.1
DDBJ      :             putative IS110 family IS900-like transposase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->180 2b0tA PDBj 5e-18 17.0 %
:RPS:SCOP  8->81 2ch5A2  c.55.1.5 * 6e-04 20.3 %
:RPS:PFM   95->171 PF01548 * Transposase_9 1e-04 43.4 %
:RPS:PFM   270->318 PF02371 * Transposase_20 3e-04 43.8 %
:HMM:PFM   271->357 PF02371 * Transposase_20 1.4e-20 38.4 86/87  
:HMM:PFM   75->171 PF01548 * Transposase_9 1.2e-18 38.9 95/96  
:HMM:PFM   11->57 PF00480 * ROK 0.0006 19.6 46/179  
:BLT:SWISS 8->401 YI90_MYCPA 9e-89 56.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67831.1 GT:GENE BAC67831.1 GT:PRODUCT putative IS110 family IS900-like transposase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(139360..140565) GB:FROM 139360 GB:TO 140565 GB:DIRECTION - GB:PRODUCT putative IS110 family IS900-like transposase GB:NOTE IS110 family (140688..139335) Inverted repeat sequence (12/15). Target sequence (GG). GB:PROTEIN_ID BAC67831.1 LENGTH 401 SQ:AASEQ MEGNVPEIWAGVDIGKTHYHCVVINADGKRLLSRRVANDESELLALIGDVLEISADALWAVDLNHGGAALLIGLLVSHGQPVAYLTGLAVHRASATYKGGEGKTDAKDAFVIADQARVRRDLGLLRPGDEIAVDLRTLTTRRLDAVFDRTRQINRLRAQLLEIFPALERALELTNRGPVVLLTGYQTPAAIRRAGASRIETWLKNRKVRGAAALAKTTVEAAQAQQTALPGEKLAAAMVVRLAKGVMALDEEIAELDALIEVKFCEHPHAEVIRSLPGMGAKLGAEFLAATGGDMDAFGSPDRLAGFAGLAPRPRDSGRVSGNLRRPRRYHRGLLRTMYLSAMVSLQCCPASKAFYDRKRGEGKGHKQALLALARRRLNVLWAMIRDGECFHTSPPVTRAA GT:EXON 1|1-401:0| BL:SWS:NREP 1 BL:SWS:REP 8->401|YI90_MYCPA|9e-89|56.8|391/399| SEG 211->228|aaalakttveaaqaqqta| SEG 324->336|lrrprryhrgllr| SEG 369->378|allalarrrl| RP:PDB:NREP 1 RP:PDB:REP 8->180|2b0tA|5e-18|17.0|147/735| RP:PFM:NREP 2 RP:PFM:REP 95->171|PF01548|1e-04|43.4|76/95|Transposase_9| RP:PFM:REP 270->318|PF02371|3e-04|43.8|48/87|Transposase_20| HM:PFM:NREP 3 HM:PFM:REP 271->357|PF02371|1.4e-20|38.4|86/87|Transposase_20| HM:PFM:REP 75->171|PF01548|1.2e-18|38.9|95/96|Transposase_9| HM:PFM:REP 11->57|PF00480|0.0006|19.6|46/179|ROK| GO:PFM:NREP 6 GO:PFM GO:0003677|"GO:DNA binding"|PF01548|IPR002525| GO:PFM GO:0004803|"GO:transposase activity"|PF01548|IPR002525| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF01548|IPR002525| GO:PFM GO:0003677|"GO:DNA binding"|PF02371|IPR003346| GO:PFM GO:0004803|"GO:transposase activity"|PF02371|IPR003346| GO:PFM GO:0006313|"GO:transposition, DNA-mediated"|PF02371|IPR003346| RP:SCP:NREP 1 RP:SCP:REP 8->81|2ch5A2|6e-04|20.3|74/117|c.55.1.5| OP:NHOMO 203 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ----232211-9----L----2--11------23-6--41-----------1--2-2-----1---5363-----6-----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7----------------------------------------------------------------2-----------------------------------------------------------------------------83----1---22--262--5-34-----------------------------------------------------------------------------------------------------------------------------------------------------1----1-12-------1----------------------------------------9E5856C----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 147 STR:RPRED 36.7 SQ:SECSTR #######cGGGEEEccccEEEEEEcTTccEEEEEEETTcEEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEccTTcHHHHHHHHHHHHHHTTc#########ccTTccEEEEcHHHHHHHHHHHHHTTcccE#################EEEcHHHHHHHHHHHHHHHHccccEEEEEcT############################################################################################################################################################################################################################# DISOP:02AL 1-3, 316-327, 394-401| PSIPRED cccccEEEEEEEEEcccEEEEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccEEEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHHHHHHHHHHHcccHHHcccHHHHHHHHcccccccccccEEEcccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccHHHcccc //