[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67833.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:344 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   211->274 3c37B PDBj 5e-08 25.8 %
:RPS:SCOP  12->53 2fbkA1  a.4.5.28 * 2e-04 30.0 %
:HMM:SCOP  1->45 1sd4A_ a.4.5.39 * 0.00078 40.9 %
:RPS:PFM   231->274 PF01435 * Peptidase_M48 3e-07 50.0 %
:HMM:PFM   227->279 PF01435 * Peptidase_M48 1.1e-12 35.8 53/225  
:HMM:PFM   1->45 PF03965 * Pencillinase_R 6.9e-11 40.9 44/115  
:BLT:SWISS 181->285 HTPX_MESSB 2e-06 37.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67833.1 GT:GENE BAC67833.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(141787..142821) GB:FROM 141787 GB:TO 142821 GB:DIRECTION - GB:PRODUCT putative membrane protein GB:NOTE PF03965: Penicillinase repressor GB:PROTEIN_ID BAC67833.1 LENGTH 344 SQ:AASEQ MAALWAAEAALTPGEVQAELASDLARTTVTTILSRLYDKGVVDRRGVAMVTTPCRTPRGSPPGACIPSSTVTLTGRPSWPASSPSSIRTTNSFCASYWRPTRDDRPLLIPLLLPFVMPLLARRALDRLAPATALWALTAAALVLAGACVTALGALVLTGLLKLPAFAALGELAHPLRTPTGYLVLPAAAIATGLLTIGAWTLAHSALRQTRAFRTARAEADRRPTAGDLCVVDSPHPDAYALPGRPHRIVVTTAMLRSLKPDERDALFAHERAHNQGATTASWSIGSAACRPGRMVSYLGACGARRAGPMRGRRGPRAIPVVCRPVPRSCRGRIVGVSLPSARW GT:EXON 1|1-344:0| BL:SWS:NREP 1 BL:SWS:REP 181->285|HTPX_MESSB|2e-06|37.1|105/313| TM:NTM 4 TM:REGION 104->121| TM:REGION 128->150| TM:REGION 154->176| TM:REGION 179->201| SEG 2->11|aalwaaeaal| SEG 106->161|plliplllpfvmpllarraldrlapatalwaltaaalvlagacvtalgalvltgll| SEG 300->318|gacgarragpmrgrrgpra| RP:PDB:NREP 1 RP:PDB:REP 211->274|3c37B|5e-08|25.8|62/216| RP:PFM:NREP 1 RP:PFM:REP 231->274|PF01435|3e-07|50.0|44/208|Peptidase_M48| HM:PFM:NREP 2 HM:PFM:REP 227->279|PF01435|1.1e-12|35.8|53/225|Peptidase_M48| HM:PFM:REP 1->45|PF03965|6.9e-11|40.9|44/115|Pencillinase_R| GO:PFM:NREP 3 GO:PFM GO:0004222|"GO:metalloendopeptidase activity"|PF01435|IPR001915| GO:PFM GO:0006508|"GO:proteolysis"|PF01435|IPR001915| GO:PFM GO:0016020|"GO:membrane"|PF01435|IPR001915| RP:SCP:NREP 1 RP:SCP:REP 12->53|2fbkA1|2e-04|30.0|40/156|a.4.5.28| HM:SCP:REP 1->45|1sd4A_|0.00078|40.9|44/0|a.4.5.39|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 4 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------1-----------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 25.3 SQ:SECSTR #####################################################################################################################################################################################################TTEccccccHHHHHHHHHHHTTccccccccEEEEEccccccEEEETTTccEEEEEHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHH############################################################ DISOP:02AL 1-2, 6-7, 309-311| PSIPRED cccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccEEEccccccccHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEccccccc //