[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67836.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.111.1b.1.18
:242 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   38->194 2a96A PDBj 4e-12 16.9 %
:RPS:SCOP  126->192 1ayrA1  b.1.18.11 * 1e-08 10.4 %
:HMM:SCOP  1->211 1d2tA_ a.111.1.1 * 7.4e-33 30.7 %
:RPS:PFM   111->195 PF01569 * PAP2 4e-06 37.3 %
:HMM:PFM   101->204 PF01569 * PAP2 2e-21 33.0 103/129  
:HMM:PFM   67->98 PF05052 * MerE 0.00029 46.9 32/75  
:BLT:SWISS 127->195 SGPP1_HUMAN 7e-06 34.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67836.1 GT:GENE BAC67836.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 144260..144988 GB:FROM 144260 GB:TO 144988 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE PF01569: PAP2 superfamily GB:PROTEIN_ID BAC67836.1 LENGTH 242 SQ:AASEQ MKRSDLGELAGSVGLGAWTAFGVLTMIVIGDGQPLYGDEDLLSWSVGHRPDVPVALARALTATGTGAIPYVLAVLAGTIAGRTLRQRAVATALCLTCLGAGQAARYGVMALVARPRPTRVDWATPASGWAFPSGHTTTAALTAGLLVIAVYTRSPPGRALLALVFGCWGALVGLTRVYLGVHWFTDVVGGWLFAVGWLGLCLCAAAWWLPEAFITGTTDIDQKPPEDHAPQDPGRRGRSRPA GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 127->195|SGPP1_HUMAN|7e-06|34.4|64/441| TM:NTM 5 TM:REGION 10->31| TM:REGION 56->78| TM:REGION 90->112| TM:REGION 147->169| TM:REGION 187->209| SEG 55->67|alaraltatgtga| SEG 136->146|tttaaltagll| SEG 196->209|gwlglclcaaawwl| RP:PDB:NREP 1 RP:PDB:REP 38->194|2a96A|4e-12|16.9|148/217| RP:PFM:NREP 1 RP:PFM:REP 111->195|PF01569|4e-06|37.3|83/132|PAP2| HM:PFM:NREP 2 HM:PFM:REP 101->204|PF01569|2e-21|33.0|103/129|PAP2| HM:PFM:REP 67->98|PF05052|0.00029|46.9|32/75|MerE| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01569|IPR000326| GO:PFM GO:0016020|"GO:membrane"|PF01569|IPR000326| RP:SCP:NREP 1 RP:SCP:REP 126->192|1ayrA1|1e-08|10.4|67/182|b.1.18.11| HM:SCP:REP 1->211|1d2tA_|7.4e-33|30.7|202/224|a.111.1.1|1/1|Acid phosphatase/Vanadium-dependent haloperoxidase| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------21------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 61.6 SQ:SECSTR #####################################HHHHHHHHHHTTTcHHHHHHHHHTcccHHHHHHHHHHHHTccccTTTcHHHHHHHHHHHHHHHHTTTTHHHHHHHccccHHHHHTcccHTccccccHHHHHH########HHHHHHHHHHcGGGHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHH################################################ DISOP:02AL 1-3, 218-242| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc //