[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67837.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  820/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:220 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   20->216 1ys6B PDBj 3e-24 43.1 %
:RPS:PDB   4->216 3c3wB PDBj 4e-22 20.2 %
:RPS:SCOP  4->105 1a0oA  c.23.1.1 * 2e-20 31.4 %
:RPS:SCOP  129->219 1gxpA  a.4.6.1 * 1e-20 36.3 %
:HMM:SCOP  2->186 1s8nA_ c.23.1.1 * 2.5e-29 29.9 %
:RPS:PFM   5->104 PF00072 * Response_reg 1e-08 38.0 %
:RPS:PFM   144->219 PF00486 * Trans_reg_C 2e-14 50.0 %
:HMM:PFM   144->219 PF00486 * Trans_reg_C 1.1e-21 46.1 76/77  
:HMM:PFM   5->113 PF00072 * Response_reg 8.4e-20 33.9 109/112  
:HMM:PFM   106->122 PF10414 * CysG_dimeriser 0.0008 52.9 17/60  
:BLT:SWISS 4->219 MPRA_MYCVP 7e-30 39.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67837.1 GT:GENE BAC67837.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 144942..145604 GB:FROM 144942 GB:TO 145604 GB:DIRECTION + GB:PRODUCT putative two-component system response regulator GB:NOTE PF00072: Response regulator receiver domain GB:PROTEIN_ID BAC67837.1 LENGTH 220 SQ:AASEQ MRHKILVVEDDHALRDVLLRGLRDEDFDPVPAPDGASALRLATRDIAASVLDIGLPDADGRDVCQAMRANGFLSPVIFLTAHHRLTDRLSGFSAGGDDYLPKPFHLAELAARLRAAVKRAAPLPAATAGDLVLDPVRHSVSVRGTPVDLTPTEFRLLAALMAASGGIVRRRELVRAGWPEGAQVSDNTLDQYLTRLRRKLRTAGSDLTVTTARGIGHRLS GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 4->219|MPRA_MYCVP|7e-30|39.8|216/231| SEG 106->128|laelaarlraavkraaplpaata| BL:PDB:NREP 1 BL:PDB:REP 20->216|1ys6B|3e-24|43.1|197/227| RP:PDB:NREP 1 RP:PDB:REP 4->216|3c3wB|4e-22|20.2|203/210| RP:PFM:NREP 2 RP:PFM:REP 5->104|PF00072|1e-08|38.0|100/111|Response_reg| RP:PFM:REP 144->219|PF00486|2e-14|50.0|76/77|Trans_reg_C| HM:PFM:NREP 3 HM:PFM:REP 144->219|PF00486|1.1e-21|46.1|76/77|Trans_reg_C| HM:PFM:REP 5->113|PF00072|8.4e-20|33.9|109/112|Response_reg| HM:PFM:REP 106->122|PF10414|0.0008|52.9|17/60|CysG_dimeriser| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 4->105|1a0oA|2e-20|31.4|102/128|c.23.1.1| RP:SCP:REP 129->219|1gxpA|1e-20|36.3|91/103|a.4.6.1| HM:SCP:REP 2->186|1s8nA_|2.5e-29|29.9|184/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 7137 OP:NHOMOORG 829 OP:PATTERN -------------------------------------------------3------------------ 6BE5H4667784559AA99-9B4489999997EBAC8CFD789D654746569AA45411DDD4I6FLGI7122243337DA6-336677A8-411---12B443E2B4A---------------32222223231FIIGI535I3WEMECB799AB765778DC9DNPPA573555565545AC65522-94BMMNMNMONFPKPPQJA96598MPV788J6CA877977NO5767777677777775667563639933314664489423565242676544465555555555555444444444444464343344435KACQIIIJKGIEJ8AMLL5786FAA669CI53UPE68235445563-25B63A99756665A6JDDC877E9CE8868888877A-DDBDDCFB7H51HHHICBFJIFBCCK59586AA4A9577AAAAAAAA7877669722111111--1112---111111112121-49D34ABA8EKIKKLKDCCC9JJKLECEE7FKKLEHHP-1DIGG6HDBRCDFJ5CHC655864-------7528EC66614131564333-C796884666556AA288425344444512-------6938933DC699A88887E7CB98DACBBCADB9EDF--13525------AA89997AAABABBCAA-ACBAAAAAACAAAAAAAA9CCC7846599899999899A9A9AD988AA9A7-9CCCCCCCBCCC---A33333222289EAD211221-222211129878A66546B7JHLJJNNPCLMOOCGHJ11111111148AAE9999979AABLNA9C9AAAA5545--C14433441-------1-1-------------------------36423434443E3 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----2-1-------2-1---------2--9-----8---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 220 STR:RPRED 100.0 SQ:SECSTR ccHEEEEEcccHHHHHHHHHHHHTcTTEEEEEccHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHEHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHTHHHHHHHHTccHHHHHHHHHHHHHHTTcccccHHHHHHHHHTEEEc PSIPRED cccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHccccccEEEEccEEEEcccEEEEEccEEEcccHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccHHHHHHHHHHHccccccccEEEEEccccEEcc //