[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67839.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:266 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   192->239 PF03988 * DUF347 1e-04 55.8 %
:HMM:PFM   1->50 PF03988 * DUF347 2.4e-16 32.0 50/55  
:HMM:PFM   52->120 PF03988 * DUF347 9.9e-13 36.0 50/55  
:HMM:PFM   135->180 PF03988 * DUF347 3.3e-17 45.7 46/55  
:HMM:PFM   190->247 PF03988 * DUF347 3e-21 58.5 53/55  
:BLT:SWISS 66->152 UPPP_BIFLO 3e-04 33.7 %
:TM
:REPEAT 2|8->70|96->154
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67839.1 GT:GENE BAC67839.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(146943..147743) GB:FROM 146943 GB:TO 147743 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:NOTE PF03988: Repeat of Unknown Function (DUF347) GB:PROTEIN_ID BAC67839.1 LENGTH 266 SQ:AASEQ MKIAATTLGETAGDLFAQTLKLGYFLTTIALFLIFVVTLVVQLRSRRYNPFFYWTVILSTSMAGTTMSDFMNRDASAKFLSGGATSLGWGPQGLGLGYPVGAAILISLLIAVFAVWKLTGMTFVIRDIVTFRGEALFWSAILVSNTLGTSMGDFLSDSSGLGYAGGALLVSGMLAMLLVLMKVPVVPNVLLFWFAFVLTRPLGATAGDFLTKPVAKGGLDLGTAGSSAVLLAILVGLMAYAQVRERRTALSSPESAEQEAVTQRAA GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 66->152|UPPP_BIFLO|3e-04|33.7|86/294| TM:NTM 5 TM:REGION 23->44| TM:REGION 103->125| TM:REGION 161->183| TM:REGION 187->209| TM:REGION 220->241| NREPEAT 1 REPEAT 2|8->70|96->154| SEG 155->191|lsdssglgyaggallvsgmlamllvlmkvpvvpnvll| RP:PFM:NREP 1 RP:PFM:REP 192->239|PF03988|1e-04|55.8|43/54|DUF347| HM:PFM:NREP 4 HM:PFM:REP 1->50|PF03988|2.4e-16|32.0|50/55|DUF347| HM:PFM:REP 52->120|PF03988|9.9e-13|36.0|50/55|DUF347| HM:PFM:REP 135->180|PF03988|3.3e-17|45.7|46/55|DUF347| HM:PFM:REP 190->247|PF03988|3e-21|58.5|53/55|DUF347| OP:NHOMO 113 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- ---------------11---------------------32-32-------------------1----21----------------------------------1---------------------11-----------------------------------------14---------------------1---------------------------------------22------------------------------------------1----------------------------------------------------------------------1-----------------------------1-----------1-1-------------------------2--1-------------------------------------1--------------------------------------21-------11121--222211-1222121221---4--212----------------11--------------2-------------------1-------------------------------------111------------1-1-2--------------------------1--------------------------------------------------------------------------------------------------------------------------1-------1211--2---11-------------------------1------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11-31- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 244-261, 264-266| PSIPRED cEEEEEcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccc //