[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67840.1
DDBJ      :             putative integral membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
:276 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->82 PF03988 * DUF347 2e-04 39.6 %
:HMM:PFM   34->87 PF03988 * DUF347 1.8e-20 38.9 54/55  
:HMM:PFM   89->141 PF03988 * DUF347 7.3e-19 41.5 53/55  
:HMM:PFM   154->205 PF03988 * DUF347 1.8e-16 34.6 52/55  
:HMM:PFM   208->265 PF03988 * DUF347 9e-21 43.4 53/55  
:HMM:PFM   121->165 PF09771 * Tmemb_18A 0.00088 24.4 45/126  
:TM
:REPEAT 2|153->175|209->230
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67840.1 GT:GENE BAC67840.1 GT:PRODUCT putative integral membrane protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(147993..148823) GB:FROM 147993 GB:TO 148823 GB:DIRECTION - GB:PRODUCT putative integral membrane protein GB:NOTE PF03988: Repeat of Unknown Function (DUF347) GB:PROTEIN_ID BAC67840.1 LENGTH 276 SQ:AASEQ MTSETSETAAVHGSAPNAPGHRLRWNKVPEVTVYFWVIKVLCTTVGETAADLLNEKAGLGLTGVSLLMSVLLAVILVVQFRTTAYRPGAYWTAVALISVVGTLVSDNLTDNMGIPLETTTAVFAVLLAVVFVAWYRSERTLSIHSIDTLRRESFYWLAVLFTFALGTSAGDLVAERMALGYWVSAVLFALAIAAVAVARFALGANAVWSFWIAYVLTRPLGASMGDYLSQPTGDGGLGLGTVVTSVLFLAVILGLVVFLAVTRKDVTEPERLARTA GT:EXON 1|1-276:0| TM:NTM 6 TM:REGION 29->51| TM:REGION 60->81| TM:REGION 115->136| TM:REGION 152->174| TM:REGION 188->210| TM:REGION 240->262| NREPEAT 1 REPEAT 2|153->175|209->230| SEG 121->133|avfavllavvfva| SEG 183->207|vsavlfalaiaavavarfalganav| SEG 232->247|tgdgglglgtvvtsvl| RP:PFM:NREP 1 RP:PFM:REP 35->82|PF03988|2e-04|39.6|48/54|DUF347| HM:PFM:NREP 5 HM:PFM:REP 34->87|PF03988|1.8e-20|38.9|54/55|DUF347| HM:PFM:REP 89->141|PF03988|7.3e-19|41.5|53/55|DUF347| HM:PFM:REP 154->205|PF03988|1.8e-16|34.6|52/55|DUF347| HM:PFM:REP 208->265|PF03988|9e-21|43.4|53/55|DUF347| HM:PFM:REP 121->165|PF09771|0.00088|24.4|45/126|Tmemb_18A| OP:NHOMO 131 OP:NHOMOORG 82 OP:PATTERN -------------------------------------------------------------------- ----1----------11---------------------33-421------------------1----21----------------------------------1---------------------11-----------------------------------------14---------------------1---------------------------------------22------------------------------------------1-11-------------------------------------------------------------------1-----------------------------1-----------1-1-------------------------3--1-------------------------------------1--------------------------------------21-------11131--222211-1222121231---7--332----------------11--------------2-------------------1-------------------------------------111------------1-1-2--------------------------1--------------------------------------------------------------------------------------------------------------------------1-------1211--2---11-------------------------1------------------------------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1----11-51- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-24, 266-276| PSIPRED ccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccc //