[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67841.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:93 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   62->89 PF01758 * SBF 8.3e-05 53.6 28/187  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67841.1 GT:GENE BAC67841.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 148993..149274 GB:FROM 148993 GB:TO 149274 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67841.1 LENGTH 93 SQ:AASEQ MTIPHSHGRTCADHATHWLRRRLGRAVALAYLAAVLLPGPGRWLRHTHTLVGTGLPLYTASLLLSLVLFSAGLQVPVRALGQLLRRPRACWQG GT:EXON 1|1-93:0| TM:NTM 2 TM:REGION 23->45| TM:REGION 51->73| SEG 19->37|lrrrlgravalaylaavll| SEG 55->73|lplytaslllslvlfsagl| HM:PFM:NREP 1 HM:PFM:REP 62->89|PF01758|8.3e-05|53.6|28/187|SBF| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 92-93| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHccc //