[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67846.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  50/68 : Bacteria  797/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:237 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   93->228 2pcjA PDBj 2e-12 29.6 %
:RPS:PDB   19->235 3dmdC PDBj 2e-14 5.9 %
:RPS:SCOP  21->215 1sgwA  c.37.1.12 * 2e-12 9.1 %
:HMM:SCOP  1->235 1pf4A1 c.37.1.12 * 9.2e-50 39.6 %
:HMM:PFM   65->177 PF00005 * ABC_tran 2e-16 37.5 104/118  
:HMM:PFM   46->67 PF01695 * IstB 0.00014 45.5 22/178  
:BLT:SWISS 21->229 LOLD_VIBF1 1e-19 28.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67846.1 GT:GENE BAC67846.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 153005..153718 GB:FROM 153005 GB:TO 153718 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:NOTE PF00005: ABC transporter GB:PROTEIN_ID BAC67846.1 LENGTH 237 SQ:AASEQ MPPRDHAIPAGKPVTSLDEVLVDCRNAALTFGRGATAVVAVHGANLWVRSADRLAIVGPSGSGKSSLLHLLAGLEQTTSGTVTWPALDGPGGIGIVFQGDSLIAALDVVENTALPLVLAGVPDGEAHRLAAEALALVDAADLAERLPEEISGGQAQRVAAARVLAQSPRLILADEPTGRLDHTTGGHVLDALLTAADQTGAALVVTTHDPAIAARLTTRLAMRGGRLLTVDEPQEAS GT:EXON 1|1-237:0| BL:SWS:NREP 1 BL:SWS:REP 21->229|LOLD_VIBF1|1e-19|28.2|209/238| SEG 58->74|gpsgsgkssllhllagl| SEG 129->146|laaealalvdaadlaerl| SEG 152->163|ggqaqrvaaarv| BL:PDB:NREP 1 BL:PDB:REP 93->228|2pcjA|2e-12|29.6|135/223| RP:PDB:NREP 1 RP:PDB:REP 19->235|3dmdC|2e-14|5.9|204/318| HM:PFM:NREP 2 HM:PFM:REP 65->177|PF00005|2e-16|37.5|104/118|ABC_tran| HM:PFM:REP 46->67|PF01695|0.00014|45.5|22/178|IstB| RP:SCP:NREP 1 RP:SCP:REP 21->215|1sgwA|2e-12|9.1|187/200|c.37.1.12| HM:SCP:REP 1->235|1pf4A1|9.2e-50|39.6|230/244|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2759 OP:NHOMOORG 855 OP:PATTERN 1112311-1121212-3-21111241122--1--1121222223115124A661---1------11-- 4542H5113332-211111-11--1211111122222453244377425225343132--3435845B9C16222755237211-1--8856-333---11313321421--------------12323321123134354--1418146111342211112221334441-111---1111-1131111-213999999AB5DDB8AE364435CBE3115444477666571111111111111111112-4212332-111222234232-1-1111112222222222222222222222222222222232-1-333145273444544423345221---4243-4222-654223323112231117245333221124384A4345655534434244347-2252244335315666544666657511333555542221111111133312267--------11--1111111111111-----3342144433266363333334446323325544467411444644668666353573344523333333573636-3522165155223167864464944458547122-111111111111111122-21--8643569453444444446444444554651-11413------45773322332232222-3222222212322222223444678443233333333333333322233224-755555545555-11422122333344732222222-1111-11211111--3244666668B78477564757211-11111224345555566455885555543413121121--3233--------32--------------------------1312132323271 ----1---31----11---------------------------------------------------------------------------------------------1-----------------------------------------------------2------------------------------4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 99.6 SQ:SECSTR EEEccccTcEEETTccHHHHHHHHHHHHTcccccccccccHHHHHHHccccEEEEEEccTTccHHHHHHHHHHHHHHTTccEEEHHHHEEEEEEEEcTTcHHHHHHHHHHHHHTTcEEEcccTTccHHHHHHHHHHHHHHHTccEEEEEEcccccTTccHHHHHHHHHHHHcccEEEEEEETTcTTTHHHHHHHHHHHccccEEEEEcGGGccccHHHHHHHHHTccEEEEEcccH# DISOP:02AL 1-18, 230-237| PSIPRED cccccccccccccccccccEEEEEEEEEEEEccccEEEEEEccccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEcccccEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccEEEEEccEEEEEccccccc //