[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67848.1
DDBJ      :             putative two-component system response regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  811/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->252 2oqrA PDBj 2e-21 29.9 %
:RPS:PDB   23->126 3cnbC PDBj 3e-13 15.4 %
:RPS:PDB   148->253 2d1vA PDBj 1e-20 36.0 %
:RPS:SCOP  23->126 1p2fA2  c.23.1.1 * 3e-15 29.7 %
:RPS:SCOP  148->252 1gxpA  a.4.6.1 * 2e-20 31.6 %
:HMM:SCOP  20->211 1s8nA_ c.23.1.1 * 3.2e-39 36.0 %
:RPS:PFM   25->125 PF00072 * Response_reg 3e-08 33.7 %
:RPS:PFM   171->251 PF00486 * Trans_reg_C 1e-09 48.0 %
:HMM:PFM   25->134 PF00072 * Response_reg 1.3e-26 34.5 110/112  
:HMM:PFM   170->251 PF00486 * Trans_reg_C 6.1e-25 51.3 76/77  
:BLT:SWISS 24->252 COPR_PSESM 2e-25 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67848.1 GT:GENE BAC67848.1 GT:PRODUCT putative two-component system response regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 156360..157139 GB:FROM 156360 GB:TO 157139 GB:DIRECTION + GB:PRODUCT putative two-component system response regulator GB:NOTE PF00072: Response regulator receiver domain GB:PROTEIN_ID BAC67848.1 LENGTH 259 SQ:AASEQ MNAPPGSTLPSMRTPAAPDRSRYRVLVVEDDDTIGRHLETGLRSNGYTPTWSRTGTGALTESAQTQYDVLLLDLGLPDMDGLDIARTLRARLPDLLIIILTARTDDIDVIAGLDAGADDYLVKPFSLTVLLARLRAHLRRRAIAAPPQQPIRLGDLVLDVTARRCTLHDREVDLRPKEFELLAVLARHAGEAVSREVLMAEVWDENWFGPTKTLDVTMAGLRRRLADAANASPIPAALPRISTLRGHGYRLEPHAVPPV GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 24->252|COPR_PSESM|2e-25|31.2|221/227| SEG 68->83|dvllldlglpdmdgld| SEG 127->145|ltvllarlrahlrrraiaa| SEG 226->239|adaanaspipaalp| BL:PDB:NREP 1 BL:PDB:REP 25->252|2oqrA|2e-21|29.9|221/226| RP:PDB:NREP 2 RP:PDB:REP 23->126|3cnbC|3e-13|15.4|104/123| RP:PDB:REP 148->253|2d1vA|1e-20|36.0|100/103| RP:PFM:NREP 2 RP:PFM:REP 25->125|PF00072|3e-08|33.7|101/111|Response_reg| RP:PFM:REP 171->251|PF00486|1e-09|48.0|75/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 25->134|PF00072|1.3e-26|34.5|110/112|Response_reg| HM:PFM:REP 170->251|PF00486|6.1e-25|51.3|76/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 23->126|1p2fA2|3e-15|29.7|101/120|c.23.1.1| RP:SCP:REP 148->252|1gxpA|2e-20|31.6|98/103|a.4.6.1| HM:SCP:REP 20->211|1s8nA_|3.2e-39|36.0|189/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 6821 OP:NHOMOORG 818 OP:PATTERN -------------------------------------------------------------------- 7AC5K365778554BAAAA-AB448BAAAAA7FBCC9CFC899C8968688697A34711HFJ5L7HLIK7444443345B86123454453-4-----216224D1865---------------32222212221EEEFF525I5IDKBCB8779A5345669A6BIIM62622222423229C64422-949LLMLMJKLCNKOOKJ9A1178MNR68BK6DD877877UQ5887877677888775566485549944334554488433465576777343451133333333333233333333333342233333325KDFQKKKMLJLELBALNN7996JEC34A9G42QOD77234546576125B34A88645445B79ABA698987788788888779-78988D9B6D51FBBGC9BHEE8A9B68644895983439999999988755876----------11-----------------136933ACB7DKJLLOKEHHHCKKMJJHJIBILKKFJHN-2GKJB8EDBJA9CH4EKB645755111111175279D66512231262221-B8867677565455716-21111111121111111114222344BA789996995C9DDB7C7CCCCDB8CEDB--23213------CB9B9C9CCCDCDCECC-CEDCCCCCCECCCCCCCCADBD9A667BABBBBBBABBBBBBBCBA9BBCC7-BAABBAABAAAA--1722222333367CAB211211122221--2A978A68667D7KIMKHLOJCJMMLCEFI22121321238AAC99999BAF9AHJ98B888884444--41333344--------1-2-------------------------3543343444483 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-1-------1-1------------7-----6---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 254 STR:RPRED 98.1 SQ:SECSTR cccHHHHHHTcccccccccEEEEEEcTTccccHHHHHHHHHHHTTTcEEEccccHHHHHHHHHHHTccEEEEEcccTHHHHHHHHHHHHccccEEEEcTTccHHHHHHHTGGGccccEEEcccHHHHHHHHHHHTcTTTHHHHHHHHcccEEETTEEEETTTTEEEETTEEccccHHHHHHHHHHHHTTTccccHHHHHHHHHcTTccccTHHHHHHHHHHHHHHcTTEHHcccTTccccEEEETTTEEEEccc##### DISOP:02AL 1-21, 140-150, 258-259| PSIPRED cccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHccccccEEccccHHHHHHHHHHHHHccccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEEHHHHHHHHHHHcccccccccccccEEEEEEcccEEEcccccccc //