[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67852.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  103/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->187 3jsjA PDBj 9e-89 100.0 %
:RPS:PDB   27->185 3crjA PDBj 6e-11 20.9 %
:RPS:SCOP  27->82 2fbqA1  a.4.1.9 * 5e-07 21.4 %
:RPS:SCOP  80->169 1sgmA2  a.121.1.1 * 3e-08 16.7 %
:HMM:SCOP  2->84 1t33A1 a.4.1.9 * 2.6e-14 33.7 %
:HMM:SCOP  78->169 2i10A2 a.121.1.1 * 6.6e-08 27.2 %
:HMM:PFM   13->57 PF00440 * TetR_N 1.5e-11 44.4 45/47  
:HMM:PFM   46->97 PF07445 * priB_priC 0.0008 32.7 49/173  
:BLT:SWISS 21->85 Y1255_MYCTU 3e-05 30.8 %
:BLT:SWISS 75->163 YJDC_SHIFL 4e-04 22.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67852.1 GT:GENE BAC67852.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(161392..161961) GB:FROM 161392 GB:TO 161961 GB:DIRECTION - GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC67852.1 LENGTH 189 SQ:AASEQ MTTEVKQSPRERLLEAAAALTYRDGVGIGVEALCKAAGVSKRSMYQLFESKDELLAASLKERSAAFVAKALPPADDGRSPRERILYVFERVESQAGAPDFQGCRYLAVQIELKDQAHPASRVAYQIKADLMAFFRSEAERGGASDPDLLARQLILVFDGASARAGIGADNLTGLIVPTLTTLLDAADMH GT:EXON 1|1-189:0| BL:SWS:NREP 2 BL:SWS:REP 21->85|Y1255_MYCTU|3e-05|30.8|65/202| BL:SWS:REP 75->163|YJDC_SHIFL|4e-04|22.5|89/191| SEG 10->20|rerlleaaaal| BL:PDB:NREP 1 BL:PDB:REP 6->187|3jsjA|9e-89|100.0|180/181| RP:PDB:NREP 1 RP:PDB:REP 27->185|3crjA|6e-11|20.9|158/185| HM:PFM:NREP 2 HM:PFM:REP 13->57|PF00440|1.5e-11|44.4|45/47|TetR_N| HM:PFM:REP 46->97|PF07445|0.0008|32.7|49/173|priB_priC| RP:SCP:NREP 2 RP:SCP:REP 27->82|2fbqA1|5e-07|21.4|56/79|a.4.1.9| RP:SCP:REP 80->169|1sgmA2|3e-08|16.7|90/111|a.121.1.1| HM:SCP:REP 2->84|1t33A1|2.6e-14|33.7|83/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 78->169|2i10A2|6.6e-08|27.2|92/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 148 OP:NHOMOORG 103 OP:PATTERN -------------------------------------------------------------------- ----1---------12-11-1----211111-1111113--1--11-1----1-1---------12321-----------------------------------------------------------------------------3-1------------------11--------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------2---------1112---1---------------------1---4--2----1221-2---------------1---------1---1----------------------------------1---1111322323122222222222212212-1--------------1----1--211-----------1--------------------------------------------------------------------1-----------------------------------------------------------------------------1--1-----------------------------------------------------1-----------------------------1111-111-1-21--------------------------------1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 96.3 SQ:SECSTR #####cccHHHHHHHHHHHHHHHTccTccHHHHHHHHTccHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHHHHTGGGGcHHHHHHHHHHHTGGGcHHHHHHHHHHHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHTTcTHHHHHHHHHHHHHHHHHH## DISOP:02AL 1-12| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccc //