[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67855.1
DDBJ      :             putative TetR-family transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:249 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   64->228 3btiB PDBj 2e-12 11.0 %
:RPS:SCOP  64->102 2fd5A1  a.4.1.9 * 7e-05 20.5 %
:RPS:SCOP  119->236 1zk8A2  a.121.1.1 * 9e-12 16.3 %
:HMM:SCOP  37->125 1t33A1 a.4.1.9 * 1.1e-11 28.4 %
:HMM:SCOP  118->236 1zk8A2 a.121.1.1 * 7.4e-19 29.5 %
:HMM:PFM   57->98 PF00440 * TetR_N 1.4e-09 35.7 42/47  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67855.1 GT:GENE BAC67855.1 GT:PRODUCT putative TetR-family transcriptional regulator GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 166102..166851 GB:FROM 166102 GB:TO 166851 GB:DIRECTION + GB:PRODUCT putative TetR-family transcriptional regulator GB:NOTE PF00440: Bacterial regulatory proteins, tetR family GB:PROTEIN_ID BAC67855.1 LENGTH 249 SQ:AASEQ MQEDLVRKWRVLTWGAADDSKPRRYREAFVTALQYDGAMARLKTHDEALRLRLLHRAAATVFDRGTAALSLRQLAADVKTSTTAVYSLFGNKAGLLRSLYEEAARLFAARLAAIRPTDDPAGDVIRLGLVYREYAIANPHLYAILFSDRSVQCPSESEPERPREAIETYRPLVDAVRRGQQAGQFGSESDPEVIALSVWGTAHGLVSLVLSGNEPPGLAVADCYERALGVLVAGWRVSEGEVQGFADVP GT:EXON 1|1-249:0| SEG 48->59|alrlrllhraaa| SEG 103->113|aarlfaarlaa| SEG 154->164|pseseperpre| RP:PDB:NREP 1 RP:PDB:REP 64->228|3btiB|2e-12|11.0|164/186| HM:PFM:NREP 1 HM:PFM:REP 57->98|PF00440|1.4e-09|35.7|42/47|TetR_N| RP:SCP:NREP 2 RP:SCP:REP 64->102|2fd5A1|7e-05|20.5|39/76|a.4.1.9| RP:SCP:REP 119->236|1zk8A2|9e-12|16.3|104/105|a.121.1.1| HM:SCP:REP 37->125|1t33A1|1.1e-11|28.4|88/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 118->236|1zk8A2|7.4e-19|29.5|105/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 34 OP:NHOMOORG 30 OP:PATTERN -------------------------------------------------------------------- ----3---------11-11-11--1-111111-111-------1-1--------------11--3111--------11------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 183 STR:RPRED 73.5 SQ:SECSTR ############################################################HHHcccccccHHHHHHTTTcccTTTTTTcccHHHHHHHHHHHHHHHHHHHHTTcTTcccHHHHHHHHHHHHHHccccTTTHHHHHHHTTcccccTTcTTTHHHHHHHHHHHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHHHHHHHccccHHHHTT###### DISOP:02AL 1-3, 16-48, 245-249| PSIPRED cccHHHHHHHEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccHHHHcccccc //