[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67856.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.134.1
:117 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->116 1q74A  c.134.1.1 * 2e-18 28.3 %
:HMM:SCOP  4->119 1q74A_ c.134.1.1 * 3.6e-06 26.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67856.1 GT:GENE BAC67856.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION 167014..167367 GB:FROM 167014 GB:TO 167367 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAC67856.1 LENGTH 117 SQ:AASEQ MTSKVYWTTAPRSMMKKFGQIMRDLGADREEPGPSEAGEGPETGLPDQEITTWVDTTEFGSQKFDALAAHASQGQNIFFLRRSKERFTQLMSVETSVRVLDTTGAPPPENDLFAGLR GT:EXON 1|1-117:0| SEG 30->42|eepgpseagegpe| RP:SCP:NREP 1 RP:SCP:REP 2->116|1q74A|2e-18|28.3|113/287|c.134.1.1| HM:SCP:REP 4->119|1q74A_|3.6e-06|26.3|114/297|c.134.1.1|1/1|LmbE-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 117-118| PSIPRED cccEEEEEcccHHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHcccEEEEEEccccccccHHHHHHccc //