[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67857.1
DDBJ      :             putative gluconolactonase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
b.68.6b.68.9
:388 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   51->385 2qe8B PDBj 3e-36 34.0 %
:RPS:PDB   181->258 1c5kA PDBj 1e-04 32.5 %
:RPS:PDB   192->221 1aomB PDBj 7e-05 23.3 %
:RPS:SCOP  178->357 1rwiA  b.68.9.1 * 2e-05 22.9 %
:HMM:SCOP  9->357 2dg1A1 b.68.6.1 * 5.5e-20 21.8 %
:RPS:PFM   107->356 PF03022 * MRJP 5e-42 47.1 %
:HMM:PFM   106->360 PF03022 * MRJP 9.1e-40 29.6 243/287  
:HMM:PFM   1->23 PF10518 * TAT_signal 1.9e-05 39.1 23/26  
:BLT:SWISS 49->280 YELL_DROER 8e-15 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67857.1 GT:GENE BAC67857.1 GT:PRODUCT putative gluconolactonase GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(167757..168923) GB:FROM 167757 GB:TO 168923 GB:DIRECTION - GB:PRODUCT putative gluconolactonase GB:NOTE PF03022: Major royal jelly protein GB:PROTEIN_ID BAC67857.1 LENGTH 388 SQ:AASEQ MNRRTFLAATTASLAATQLAGPAYAYAYSSSPSGSTAVHYAVVARFWGAMPTGVTVSRRGRIFVNFPRWGDDVPFTVAELRGGKPVAYPDAEVNRQDASDLAGHFQSVQSVVVDGADRLWILDTGSPGFAGSSYGGPKLVAVDLRTDRIVRKILFPPEVVPANSYLNDVRFDLRRGAEGTAFITDSGGSNGIVVVDLATGRSWRRLTGHPSALPDERFLPVIDGEPFMVRPAGGEPTYYETGSDGIALSADGTRLYYCPLSSRRLHSVSTDALANPDATDAEVAATVEDLGFKPMADGLESDDKGRLYGGDLEHNAIWRRSPNGTYRTLAQGRDLLWVDTLSVASDRHLYAIANQLNRLSPFHEGKDLRRKPYLLVRLPIDAGPVRLV GT:EXON 1|1-388:0| BL:SWS:NREP 1 BL:SWS:REP 49->280|YELL_DROER|8e-15|31.2|221/541| SEG 7->35|laattaslaatqlagpayayayssspsgs| BL:PDB:NREP 1 BL:PDB:REP 51->385|2qe8B|3e-36|34.0|315/332| RP:PDB:NREP 2 RP:PDB:REP 181->258|1c5kA|1e-04|32.5|77/397| RP:PDB:REP 192->221|1aomB|7e-05|23.3|30/559| RP:PFM:NREP 1 RP:PFM:REP 107->356|PF03022|5e-42|47.1|238/269|MRJP| HM:PFM:NREP 2 HM:PFM:REP 106->360|PF03022|9.1e-40|29.6|243/287|MRJP| HM:PFM:REP 1->23|PF10518|1.9e-05|39.1|23/26|TAT_signal| RP:SCP:NREP 1 RP:SCP:REP 178->357|1rwiA|2e-05|22.9|166/256|b.68.9.1| HM:SCP:REP 9->357|2dg1A1|5.5e-20|21.8|280/0|b.68.6.1|1/1|Calcium-dependent phosphotriesterase| OP:NHOMO 156 OP:NHOMOORG 73 OP:PATTERN -------------------------------------------------------------------- --1----------------------------------------------------------------1-------------------------------------3----------------------------------------1---22---------------1-----------------1-------1-------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------32-14-44------------1------------------22222222-442-----------------------------------------------1-1-------1---------1---------------------------------------------------------1-1-1-----------------------------------------------1---11-1-1------1--------------------------------------------------------1---------------------------------------------------------------------------------------1-------1-------1-2------------------------1----------------------------------------------------------------------1- --------------12332-----2---------------------32-----------111----------1-----------------423-2--------------13-------------------------------------------------------3687A------------------3--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 325 STR:RPRED 83.8 SQ:SECSTR ##################################################EEEEEEcTTccEEEEEcGGGc##cccEEEEETTEEEEccccccccccc######cccEEEEEEEEEcccccccTTcccGGGccccEEEEEEEETTTTEEEEEEEEcTTcccEEEEEccGGGTTccccEEEEEEEccTTcccEEEEETTTTEEEEEEccTTcccEEEEEEHHTTcccEEEETTcccccccccEEEEEEEcTTccEEEEEEcccE##EEEEHHHHTcTTccHHHHHHTcEEEEEccccccEEEcTTccEEEEEGGGTEEEEETTTTEEEEEEEcGGGccEEEEEEcTTccEEEEEccGGGcGGGcTTcccccccEEEEEEccccccc### DISOP:02AL 1-2, 30-33, 279-283, 296-299| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccccEEEEEcccEEEEEccccccccEEEEEEccccccccccHHHHccccccccccEEEEEEEEEcccccEEEEEEcccccccccccccEEEEEEcccccEEEEEEccccccccccEEEEEEEEEccccccEEEEEccccccEEEEEEcccccEEEEEEccccccccccccEEEccEEEEEcccccccEEEccccEEEEEcccccEEEEEEccccEEEEEEHHHHccccccHHHHHHHHHHccccccccEEEEccccEEEEEEEcccEEEEEccccEEEEEEccccccccccEEEccccEEEEEEccccccccccccccccccccEEEEEEcccccEEEc //