[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptomyces avermitilis MA-4680 (save0)
Gene : BAC67858.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   3->117 3cpoA PDBj 6e-12 15.8 %
:RPS:SCOP  3->117 1c7hA  d.17.4.3 * 2e-11 15.8 %
:HMM:SCOP  2->122 1qjgA_ d.17.4.3 * 6e-17 22.5 %
:RPS:PFM   15->77 PF07366 * SnoaL 8e-05 34.4 %
:HMM:PFM   14->83 PF07366 * SnoaL 8.3e-08 20.6 68/126  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAC67858.1 GT:GENE BAC67858.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00135CH01 GT:ORG save0 GB:ACCESSION GIB00135CH01 GB:LOCATION complement(169217..169735) GB:FROM 169217 GB:TO 169735 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE PF07366: SnoaL-like polyketide cyclase GB:PROTEIN_ID BAC67858.1 LENGTH 172 SQ:AASEQ MSETLDSAATTIARWRSAEERGDVDAAVACLSPDVVLSSPLTDQFRFEGSDQLRDFLTSAFAAVKDVHYHTQTGEGDTYALVYRARVGSQSFEEVQMLRLDNQARITEITLFGRPMPALTALMHLMGPALARQQGRRGLATLMSVSTVPIHAMVSSGDRSMVAKTRPAARQP GT:EXON 1|1-172:0| RP:PDB:NREP 1 RP:PDB:REP 3->117|3cpoA|6e-12|15.8|114/122| RP:PFM:NREP 1 RP:PFM:REP 15->77|PF07366|8e-05|34.4|61/126|SnoaL| HM:PFM:NREP 1 HM:PFM:REP 14->83|PF07366|8.3e-08|20.6|68/126|SnoaL| RP:SCP:NREP 1 RP:SCP:REP 3->117|1c7hA|2e-11|15.8|114/123|d.17.4.3| HM:SCP:REP 2->122|1qjgA_|6e-17|22.5|120/125|d.17.4.3|1/1|NTF2-like| OP:NHOMO 10 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------1-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111--1-1--------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 82.0 SQ:SECSTR ccccHHHHHHHHHHHHHHHHHTcHHHHHHHEEEEEEEEccTTccEcEEHHHHHHHHHHHHcccEEEEccccEEccccEEEEEEEEEEEEEEEEEEEEEEEcTTccEEEEEEEccGGGEEHHHHHHHHTTcGGGcccTTccc############################### DISOP:02AL 1-5, 168-172| PSIPRED ccccHHHHHHHHHHHHHHHHHccHHHHHHHcccccEEccccccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEcccccEEEEEEEEEEEcccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHEEEcccccHHHHccccccccc //